(data stored in ACNUC7421 zone)

EMBL: CP001630.PE390

CP001630.PE390       Location/Qualifiers
FT   CDS_pept        436286..437110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0397"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mes:Meso_1610
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34364"
FT                   /db_xref="GOA:C6WGP8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP8"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU34364.1"
FT                   /translation="MIVDAHHHVWDLAVRDQPWITGRMSRIRRDFTVHDLAGAAPEVTT
FT                   TVLVQTVAGPAETPELLALADREPLVGAVVGWLDLTGDVPAQLAALRSLPGARWLRGVR
FT                   HQVQVEHDPDWLIRPDVLRGLAAVAADGLVYELLTLPHQLPAARRAAAALPQLTFVLDH
FT                   CSKPPVGGDLREWAAEVRALAARPNVLCKLSGLVTEADWANWSVTDLRPVCATVLEAFG
FT                   PRRLMFGSDWPVCLLAASHAEVLAAARELTADLSAAERAALFSTTATLAYRL"
     gtgatcgtcg acgcgcacca ccacgtgtgg gacctggcgg tccgcgacca gccgtggatc        60
     accgggcgga tgtcccgcat ccgcagggac ttcaccgtcc acgacctcgc cggggccgcc       120
     cccgaggtga ccacgaccgt cctggtccag accgtcgccg ggcccgccga gaccccggag       180
     ctgctcgcgc tcgccgaccg cgagcccctg gtgggggcgg tggtcggctg gctggacctg       240
     accggcgacg tccccgccca gctcgcggcc ctgcggtcgc tgcccggcgc gcgctggctg       300
     cgcggcgtcc ggcaccaggt gcaggtcgag cacgacccgg actggctgat ccggcccgac       360
     gtcctgcgcg ggctggcggc ggtcgcggcg gacgggctgg tgtacgagct gctgaccctg       420
     ccgcaccagc tcccggcggc ccgcagggcg gcggcggccc tgccgcagct gaccttcgtg       480
     ctcgaccact gctccaagcc cccggtgggc ggagacctgc gcgagtgggc ggcggaggtg       540
     cgcgcgctgg cggcccgccc gaacgtgctg tgcaagctgt ccgggctcgt caccgaggcc       600
     gactgggcga actggtcggt gacggacctg aggccggtct gcgcgaccgt cctggaggcg       660
     ttcgggccgc gccgcctgat gttcggctcg gactggccgg tctgcctgct ggccgcgagc       720
     cacgcggagg tcctggcggc ggcccgcgag ctgaccgccg acctgtccgc ggccgagcgc       780
     gccgccctgt tctcgaccac cgcgaccctc gcctaccgcc tgtga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page