(data stored in ACNUC7421 zone)

EMBL: CP001630.PE391

CP001630.PE391       Location/Qualifiers
FT   CDS_pept        437177..438277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0398"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; KEGG: bcz:pE33L466_0099
FT                   D-stereospecific peptide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34365"
FT                   /db_xref="GOA:C6WGP9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP9"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACU34365.1"
FT                   /translation="MRTTITALAAAALLLAATAPAQAAPAVPPLNRTALAAAVAGLPDG
FT                   EASGALVRVSGRAGSWTGSGGVSRLGTTRPVSPEGRFRIGSATKLLTAAAVLRLDERGV
FT                   LDLDDTVQQHLPDLLPAAFEPITVRQLLNHTHGIAGNGLPHKSTGWFAENRYRTWDPRE
FT                   VVELGVAKGPLHRPGDEQRYGNQGYLVAGLVIEAATGRPYADSVRDLVIRPLGLRDTYL
FT                   PGAETGIRGEHSHGYQLREDGSHWDVTGANPTFQWAAAEAVSSARDLDRLINALMFGDL
FT                   IGERSRAEMLTLPLPGAAHGLGVNRIELGGVVLWGKTGDRPGYNTGVAVTEDGSRTIVY
FT                   SVNTLDMEAGELPPVAQRIITAALTP"
     atgcgcacaa cgatcaccgc actggccgcc gccgcgctcc tgctggcggc gacggccccg        60
     gcccaggcgg cgcccgccgt ccccccgctc aaccgcaccg cgctggccgc cgccgtggcg       120
     ggcctgccgg acggggaggc gtccggggcg ctggtccgcg tctccggccg ggcgggctcc       180
     tggaccggct cgggcggcgt ctcccggctc ggcacgaccc gcccggtgtc cccggagggc       240
     cggttccgca tcggcagcgc cacgaagctc ctgaccgccg ccgccgtgct ccgcctcgac       300
     gagcgcggcg tgctcgacct ggacgacacc gtgcagcagc acctgcccga cctgctgccc       360
     gccgcgttcg agccgatcac cgtgcggcag ctgctgaacc acacccacgg catcgcgggc       420
     aacggcctgc cgcacaagag caccggctgg ttcgccgaga accgctaccg cacctgggac       480
     ccgcgcgagg tggtggagct gggcgtggcg aagggcccgc tgcaccgccc cggcgacgag       540
     cagcgctacg gcaaccaggg ctacctggtg gcgggcctgg tgatcgaggc ggcgaccggg       600
     aggccgtacg cggactcggt gcgggacctg gtgatccgcc cgctggggct gcgcgacacc       660
     tacctccccg gcgccgagac cgggatcagg ggcgagcact cgcacgggta ccagctgcgg       720
     gaggacggct cccactggga cgtgacgggg gcgaacccga cgttccagtg ggcggcggcg       780
     gaggcggtct ccagcgcgcg cgacctggac cggttgatca acgcgctgat gttcggcgac       840
     ctgatcggcg agcgctcgcg ggcggagatg ctgacgttgc cgctccccgg cgcggcgcac       900
     gggctgggcg tgaaccggat cgagctgggc ggcgtggtgc tgtggggcaa gacgggcgac       960
     cggcccggct acaacacggg cgtcgcggtg accgaggacg ggtcgcgcac gatcgtctac      1020
     tcggtgaaca ccctggacat ggaggcgggc gagcttccgc cggtggccca gcggatcatc      1080
     accgcggccc tgaccccctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page