(data stored in ACNUC7421 zone)

EMBL: CP001630.PE392

CP001630.PE392       Location/Qualifiers
FT   CDS_pept        complement(438344..439018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0399"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   csa:Csal_0365 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34366"
FT                   /db_xref="GOA:C6WGQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACU34366.1"
FT                   /translation="MAVTDDAILRVREMIVSGELKPGDRLPREAVLAERLGLSRNSLRE
FT                   AVKALSLVRVLDVRQGDGTYVSSLRADELLGALSFVLDLHRGEESLLEVVQVRRILEPA
FT                   ACALAAQRVTAEDAAALRALCDAAEAAETVEELVEHDLAFHRAVAAHSGNAYLAQLLDT
FT                   LAGPTVRARIWRGIAQAGAKSRTVAEHRAIVDALAAGQPEVARSWSTVHIAGVEQWLLV
FT                   LA"
     gtggccgtta ccgacgacgc gatcctgcgc gttcgggaga tgatcgtctc cggggagctc        60
     aagcccggtg accggttgcc ccgcgaggcc gtgctcgccg agcggttggg gttgtcgcgg       120
     aactcgttgc gcgaggcggt caaggcgctg tcgctggtgc gggtgctgga cgtgcggcag       180
     ggggacggga cctacgtgtc gagcctgcgg gccgacgagc tgctcggggc cctgtcgttc       240
     gtgctcgacc tgcaccgggg cgaggagtcg ctgctggagg tcgtgcaggt ccggcgcatc       300
     ctggaaccgg cggcgtgcgc gctcgcggcc cagcgggtga ccgccgagga cgccgccgcg       360
     ctgcgggcgc tgtgcgacgc ggccgaggca gccgagacgg tggaggagct ggtcgagcac       420
     gacctggcgt tccaccgggc cgtcgccgcg cactccggga acgcctacct ggcgcagctg       480
     ctggacacgc tcgccgggcc gacggtgcgg gcccggatct ggcggggcat cgcccaggcc       540
     ggggccaagt cgcggaccgt ggccgagcac cgggcgatcg tggacgcgct cgccgccggg       600
     cagccggagg tggcgcggtc gtggagcacg gtgcacatcg ccggggtcga gcagtggctg       660
     ctggtgctgg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page