(data stored in ACNUC7421 zone)

EMBL: CP001630.PE393

CP001630.PE393       Location/Qualifiers
FT   CDS_pept        complement(439140..440183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0400"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_1598
FT                   glutamine--fructose-6-phosphate transaminase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34367"
FT                   /db_xref="GOA:C6WGQ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ1"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ACU34367.1"
FT                   /translation="MTEHQPGGHMAAEIDQQPAIFADLVSRRAEIAAVAEAIRGRAPRF
FT                   VLFAARGSSDHAALYAKYLTEVLLQLPAGLVSPSTTTLYGARPDLRDVLLVTVSQSGGS
FT                   PDLLEVTQSARERGALTVAVTNTPESELNGVAEMSVDVGAGVEHAVAATKTYSATLLAL
FT                   YLMVDAVRGGSGAEVAGIGELARAALDGSVDPVEEAVRRYRFVDRVLTTGRGYSLPSAL
FT                   EAALKLAETSYLAARAYSGADLLHGPVAAVDAETAVLAVTSAGLGGDALHDVLDVVHGR
FT                   GADVVAVGSAAEKAPAALRIPVPETAEEVAPILEILPVQRLAHGLALARGGDPDSPRGL
FT                   NKVTRTR"
     atgaccgagc accagcccgg cgggcacatg gccgccgaga tcgaccagca gcccgcgatc        60
     ttcgcggacc tggtgtcccg gcgcgccgag atcgcggcgg tcgccgaggc gatccggggg       120
     cgcgcgcccc gcttcgtgct gttcgccgcg cgcgggtcca gcgaccacgc ggcgctgtac       180
     gccaagtacc tgaccgaggt gctgctccaa ctgcccgcgg gcctggtgtc gccgtccacc       240
     accacgctct acggggcgcg gccggacctg cgggacgtgc tgctggtgac cgtgtcgcag       300
     agcggcgggt cgccggacct gctggaggtc acgcagtccg cgcgggagcg gggggcgctg       360
     accgtggcgg tgacgaacac gcccgagtcg gagctgaacg gggtcgccga gatgtcggtg       420
     gacgtcggcg cgggcgtcga gcacgcggtg gcggccacga agacgtactc ggcgacgctg       480
     ctggcgctgt acctgatggt cgacgcggtg cgcggcggca gcggggccga ggtcgcaggc       540
     atcggcgagc tggcgcgggc ggcgctggac gggtcggtgg acccggtcga ggaggcggtg       600
     cggcgctacc ggttcgtgga ccgggtgctg accaccgggc gcggctactc gctgccgtcg       660
     gccctggagg cggcgctgaa gctggccgag acctcgtacc tggcggcgcg ggcctacagc       720
     ggcgcggacc tgctgcacgg gccggtcgcg gcggtcgacg cggagacggc ggtgctggcg       780
     gtgaccagcg ccgggctggg cggggacgcg ctgcacgacg tgctggacgt ggtgcacggg       840
     cgcggggcgg acgtggtggc ggtcgggtcg gcggcggaga aggcgcccgc ggcgctgcgc       900
     atcccggtcc cggagacggc cgaggaggtg gcgccgatcc tggagatcct gccggtgcag       960
     cggttggcgc acgggctggc cctggcacgg ggcggggacc cggacagccc cagggggttg      1020
     aacaaggtga cgcggacgcg gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page