(data stored in ACNUC7421 zone)

EMBL: CP001630.PE394

CP001630.PE394       Location/Qualifiers
FT   CDS_pept        complement(440530..441351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: jan:Jann_3555
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34368"
FT                   /db_xref="GOA:C6WGQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34368.1"
FT                   /translation="MRAKRISANAVALVVALFFAFPTYWMVATALKPRKDLLSTDYDLV
FT                   PKTVTGDNFASAWNKPGFLESLGNSLLVTLSAVAAALVVGLLAALALSRMRFRGRRGFV
FT                   MMMLIAQMAPFEALLIPMFLMMRDLDLLDKLPSLTLIYFAVTLPFCAWTLRGFVNGIPL
FT                   ELEEAAMVDGCGRWGAFRRVTLPLLGPGLVATSVFAFVTAWNEFLYALSLINDQSKQTL
FT                   PVWLSGFKSNFGTDWGGAMAASALFTLPVLVFFLIVQRKMVTGVTAGAVKG"
     gtgagggcca agcggatctc ggccaacgcg gtcgcgctcg tggtggcgct gttcttcgcg        60
     ttcccgacgt actggatggt cgccacggcg ctcaagccgc gcaaggacct gctgtccacc       120
     gactacgacc tggtgccgaa gacggtgacc ggggacaact tcgcgtcggc gtggaacaag       180
     ccggggttcc tggagtcgct gggcaacagc ctgctggtga cgctgtcggc ggtggcggcg       240
     gccctggtcg tcgggctgct ggcggcgctg gcgctgtccc ggatgcggtt ccgggggcgg       300
     cgcgggttcg tgatgatgat gctgatcgcg cagatggcgc cgttcgaggc gctgctgatc       360
     ccgatgttcc tgatgatgcg ggacctggac ctgctcgaca agctgccatc gctgacgctg       420
     atctacttcg cggtgacgct gccgttctgc gcgtggacgc tgcgcgggtt cgtcaacggc       480
     atcccgctgg agctggagga ggcggcgatg gtcgacgggt gcgggcggtg gggcgcgttc       540
     cggcgcgtga cgctgccgct gctcgggccg gggctggtgg cgacgtcggt gttcgcgttc       600
     gtgacggcgt ggaacgagtt cctgtacgcg ctgtcgctga tcaacgacca gtcgaagcag       660
     acgctgccgg tgtggctgag cgggttcaag tcgaacttcg ggacggactg gggcggtgcg       720
     atggcggcct cggcgctgtt cacgctgccg gtgctggtgt tcttcctgat cgtgcagcgg       780
     aagatggtga ccggggtcac cgccggggcg gtcaaggggt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page