(data stored in ACNUC7421 zone)

EMBL: CP001630.PE395

CP001630.PE395       Location/Qualifiers
FT   CDS_pept        complement(441348..442340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0419 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34369"
FT                   /db_xref="GOA:C6WGQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34369.1"
FT                   /translation="MTAVDTTGAGASTGNVPPAPPRSAKGGGGRRRGSAFDRALPYLLL
FT                   APALVAILWLIGFPVLSVLLTSFRRLNLRELTRGQVVWTGLDNYTEVLGDPDFWLVTGR
FT                   TVAFTAAVVGASVLAGLLLAVLMRQVSPLVRIVLQVAMLLAWAMPLLAATTVYQWIFDQ
FT                   EYGILNKTLVQLGFDSYAGYSWFSTGLSTLGVVGLMITWQAVPFLAFSLYAGLIGIPRD
FT                   QYEAAGIDGASPWQTFRAVTWPELRPLLMMVTFLSVLWDFKVFAQIWAFRQGGPDGAST
FT                   TLAVYQYLVGISQSHFGVAAAVSVVMMLLLAAVTFQYLRRLVRSQEGEL"
     atgacggcag tcgacacgac cggcgcgggg gcgtcgacgg gcaacgtccc gccggcgccc        60
     ccgcgctccg cgaagggcgg cggtggccgc cgccggggca gcgcgttcga ccgcgcgctg       120
     ccgtacctgc tgctggcgcc cgcgctggtg gccatcctgt ggctgatcgg cttccccgtg       180
     ctgtcggtgc tgctgaccag cttccggcgg ctgaacctgc gcgagctcac gcgcggccag       240
     gtcgtgtgga cggggctgga caactacacc gaggtgctgg gcgacccgga cttctggctc       300
     gtgaccgggc ggacggtggc gttcaccgcc gccgtcgtcg gggcctcggt gctggcgggc       360
     ctgctgctgg ccgtgctgat gcggcaggtc tcgccgctgg tgcggatcgt gctccaggtg       420
     gcgatgctgc tggcgtgggc gatgccgctg ctggcggcca ccacggtcta ccagtggatc       480
     ttcgatcagg agtacggcat cctgaacaag accctggtgc agctgggctt cgactcgtac       540
     gccgggtact cgtggttctc caccgggctg tccacgctgg gcgtggtcgg gctgatgatc       600
     acctggcagg ccgtgccgtt cctggcgttc tcgctgtacg ccgggctgat cggcatcccg       660
     cgcgaccagt acgaggcggc gggcatcgac ggggcgtcgc cgtggcagac gttccgggcg       720
     gtgacgtggc cggagctgcg cccgctgctg atgatggtga cgttcctgtc ggtgctgtgg       780
     gacttcaagg tgttcgcgca gatctgggcg ttccggcagg gcggtcccga cggggccagc       840
     accacgctcg cggtctacca gtacctggtg ggcatctcgc agagccactt cggcgtggcg       900
     gcggcggtga gcgtggtgat gatgctgctg ctcgcggcgg tgacgttcca gtacctgcgc       960
     aggctggtgc ggtcccagga gggtgagctg tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page