(data stored in ACNUC7421 zone)

EMBL: CP001630.PE397

CP001630.PE397       Location/Qualifiers
FT   CDS_pept        443873..444622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0404"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bcy:Bcer98_2752 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34371"
FT                   /db_xref="GOA:C6WGQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU34371.1"
FT                   /translation="MLETSLESRSRAQREPKYWGLKRHLLDLLRAMPPGSPIPTERSLA
FT                   SEFDVSRTTVRQALAELTVEGRLLRVQGKGTFAAEPKVAQRLQLSSYTQDMLAQGRQPS
FT                   SRLIDASEQPAEAELARLLGVRAGAKVLRLHRLRLADGEPMAIETTHLALGRFRGLRRY
FT                   LSPGGSLYQVLRERFGTEMGHAEETIETALASPEEAELLGADIGLPMLLLSRHSYDTEG
FT                   NPVEWVRSVYRGDRYKFVATLNRPVEG"
     atgctggaga cgagcctgga gtccaggtcg cgtgcacagc gggaaccgaa gtactggggc        60
     ctcaaacgcc acctgctcga cctgctgcgc gccatgccgc cgggttcgcc gatccccacc       120
     gagcgctcgc tcgcctcgga gttcgacgtg tcccgcacga cggtgcgcca ggcgctggcc       180
     gagctgaccg tcgagggcag gctgctgcgg gtgcagggca agggcacgtt cgccgcggaa       240
     cccaaggtgg cgcaacggct ccagctctcc tcgtacacgc aggacatgct ggcgcagggc       300
     cgccagccgt cgtcccggct gatcgacgcc tccgagcagc ccgccgaggc cgagctggcc       360
     cggctgctgg gcgtgcgggc gggggcgaag gtgctgcggc tgcaccggct gaggctggcc       420
     gacggcgagc cgatggcgat cgagaccacg cacctggcgc tcggccggtt ccgggggctg       480
     cggcggtacc tgtcgcccgg cgggtcgctg taccaggtgc tgcgcgagcg gttcggcacc       540
     gagatggggc acgccgagga gaccatcgag accgcgctcg cctcgcccga ggaggcggag       600
     ctgctgggcg cggacatcgg actgcccatg ctgctgctct cccgccactc ctacgacacc       660
     gagggcaacc cggtggagtg ggtgcgctcg gtgtaccggg gcgaccgcta caagttcgtc       720
     gcgaccctga accgcccggt cgagggctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page