(data stored in ACNUC7421 zone)

EMBL: CP001630.PE398

CP001630.PE398       Location/Qualifiers
FT   CDS_pept        complement(444671..445618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0405"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: aba:Acid345_2084 pyridoxal-5'-phosphate-
FT                   dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34372"
FT                   /db_xref="GOA:C6WGQ6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ6"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACU34372.1"
FT                   /translation="MDLVTLEDIRAAAERISGAVLRTPLLPWGDGLWLKPESLQPVGAF
FT                   KIRGAYNALARLTPEDRARGVVAYSSGNHSQAVARAAREFGVPAVIVIPDNAPEVKVEA
FT                   TRALGAEVVRVPMAERESRALELAAERGAVLVPPFDHPDVIAGQGTIGLEIVADLPEVA
FT                   TVLVPVSGGGLLSGVAVAVKALRPDARVIGVEPELAADAGESFAAGRRVDWPAEDRART
FT                   IADGLRAQPSERTFAHIRAHVDGFAAVSEARIRAAVRELAVRARLVVEPSGATTLAAFL
FT                   ELRERGELGDGPVVAVLSGGNVDPALLAEVLREA"
     gtggacctcg tgacgctgga agacatccgg gccgccgccg agcggatctc cggggcggtg        60
     ctgcgcacgc cgctgctgcc gtggggcgac ggcctctggc tcaagccgga gagcctgcaa       120
     ccggtgggcg cgttcaagat caggggcgcc tacaacgcgc tcgcccgcct cacgcccgag       180
     gaccgggcgc gcggggtggt ggcctactcc agcgggaacc actcgcaggc cgtcgcgcgc       240
     gcggcgcggg agttcggcgt gcccgccgtg atcgtgatcc cggacaacgc gcccgaggtc       300
     aaggtcgagg cgacgcgcgc gctcggggcc gaggtggtcc gggtgccgat ggccgagcgg       360
     gagagccggg cgctggagct ggccgccgag cgcggcgcgg tgctggtgcc gccgttcgac       420
     cacccggacg tgatcgccgg gcagggcacg atcgggctgg agatcgtggc cgacctgccg       480
     gaggtcgcga ccgtgctcgt gccggtcagc ggcggcggcc tgctgtccgg cgtggcggtg       540
     gcggtgaagg cgctgcggcc ggacgcgcgg gtgatcggcg tggagccgga gctggccgcc       600
     gacgcgggcg agtccttcgc ggccggacgt cgggtggact ggcccgccga ggaccgggcc       660
     aggaccatcg cggacgggct gcgggcccag ccgtcggagc ggacgttcgc gcacatccgg       720
     gcgcacgtgg acgggttcgc ggcggtctcc gaggcccgga tcagggcggc ggtgcgggag       780
     ctggcggtgc gggcgcggct ggtggtggag cccagcgggg cgacgaccct ggcggcgttc       840
     ctggagctgc gcgagcgcgg cgagctgggc gacgggccgg tcgtggcggt gctgtcgggc       900
     ggcaacgtgg acccggcgct gctcgccgag gtgctgcggg aggcgtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page