(data stored in ACNUC7421 zone)

EMBL: CP001630.PE399

CP001630.PE399       Location/Qualifiers
FT   CDS_pept        complement(446394..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0406"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: scl:sce0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34373"
FT                   /db_xref="GOA:C6WGQ7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ7"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACU34373.1"
FT                   /translation="MPVLYLGHGAPPLADDARWTGELHAWSEDLPRPEAVLVVSAHWEE
FT                   APLTLGATTPVPLTYDFWGFPQKYYEVTYDAPGAPALADEVTRLLGGDDRVARDPERGL
FT                   DHGAYVPLKELFPAADVPVLQVSMPTLDPRELFDLGRGLAPLREQGVLLVGSGFMTHNL
FT                   SCVDFRRGPDYAAPGWSEEFDDWAGRALAAGDVDGLLDFARKAPAAGVAHPRTEHLAPL
FT                   FVALGASLDQSAPRTAVEGFWYGLSKRSMQFG"
     atgcctgtgc tctacctggg ccacggggcg cccccgctgg ccgacgacgc gcgctggacc        60
     ggcgagctgc acgcctggtc cgaggacctc ccccgcccgg aggcggtcct ggtggtgtcc       120
     gcgcactggg aggaggcgcc gctcaccctc ggcgccacca cccccgtgcc gctgacctac       180
     gacttctggg gcttcccgca gaagtactac gaggtcacct acgacgcgcc gggcgcgccc       240
     gcgctcgccg acgaggtcac ccggctgctc ggcggcgacg accgggtggc ccgcgacccg       300
     gagcgcgggc tcgaccacgg ggcctacgtg ccgctgaagg agctgttccc ggcggcggac       360
     gtgccggtgc tccaggtgtc catgccgacc ctggacccgc gcgagctgtt cgacctcggc       420
     cgcgggctcg cgccgctgcg cgagcagggc gtgctgctgg tcggcagcgg gttcatgacg       480
     cacaacctga gctgcgtgga cttccggcgc ggcccggact acgccgcgcc cggctggtcc       540
     gaggagttcg acgactgggc gggccgggcg ctggccgccg gggacgtgga cgggctgctg       600
     gacttcgcgc gcaaggcccc cgccgccggt gtcgcgcacc cgcgcaccga gcacctcgcg       660
     ccgctgttcg tggcgctcgg cgcgagcctg gaccagagcg cgccgaggac cgccgtcgag       720
     gggttctggt acgggctgtc caagcgctcg atgcagttcg gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page