(data stored in ACNUC7421 zone)

EMBL: CP001630.PE4

CP001630.PE4         Location/Qualifiers
FT   CDS_pept        4728..5843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33978"
FT                   /db_xref="GOA:C6WCF7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF7"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU33978.1"
FT                   /translation="MYVRHLQVTDFRSWEHADLAFEPGVNVLVGRNGHGKTNLVEALGY
FT                   VATLGSHRVASDAPLIRSGAQRAVVRTAVVNEGRELLVELEITPGRANRARVNRGPVPR
FT                   PRDVLGILRTVLFAPEDLSLVRGDPGERRRFLDELLTLRAPRYAGVRSDYERVLRQRGA
FT                   LLKTVRSVRSAELGTLDVWDGHLAKHGAELLAARLDLVAAIAPHAAAAYAEVAPESRPA
FT                   LLSYRSSLGEAFPGTHDREVLEDALLAELHRLRPQEIDRGVCLVGPHRDDLELSLGELP
FT                   AKGYASHGESWSFALALRLGAYELLREEGAEPVLVLDDVFAELDRGRRRQLAKVAAAAE
FT                   QVFITAAVAEDVPEELDAARFHVGHGEVRRD"
     ttgtacgtcc ggcacctcca ggtgaccgac ttccggtcgt gggagcacgc ggacctggcc        60
     ttcgagccgg gggtcaacgt gctggtcggt cgcaacggcc acggcaagac gaacctggtc       120
     gaagcgctcg gctacgtcgc cacgctcgga tcgcaccggg tggcgtcgga cgcgccgctg       180
     atccggagcg gcgcccagcg cgccgtcgtc cggacggcgg tggtcaacga ggggcgcgag       240
     ctcctcgtcg aactggagat cactccgggc agggcgaacc gggcgcgggt caaccgcggc       300
     ccggttcccc ggccccgcga cgtgctcggc atcctgcgca cggtgctctt cgcgccggag       360
     gacctgtcgc tggtccgggg cgaccccggc gagcgcaggc ggttcctgga cgagctgctg       420
     accctgaggg cgccccggta cgccggggtg cgctcggact acgagcgggt gctgcggcag       480
     cgcggggcgc tgctgaagac ggtgcgctcg gtgcggtcgg cggagctggg cacgctcgac       540
     gtgtgggacg ggcacctggc caagcacggg gccgagctgc tcgcggccag gctcgacctg       600
     gtcgccgcga tcgccccgca cgccgccgcc gcgtacgccg aggtggcccc cgagtcgcgg       660
     cccgcgctgc tgtcctaccg gtcgagcctg ggggaggcgt tccccggcac gcacgaccgg       720
     gaggtgctgg aggacgcgct gctcgccgag ctgcaccggc tgcgcccgca ggagatcgac       780
     cggggcgtgt gcctggtcgg cccgcaccgg gacgacctgg agctgtcgct gggggagctg       840
     cccgcgaagg gctacgccag ccacggcgag tcgtggtcgt tcgcgctcgc gctgcgcctg       900
     ggcgcgtacg agctgctgcg cgaggagggt gccgagccgg tgctggtgct cgacgacgtg       960
     ttcgccgagc tggaccgggg caggcggcgg cagctggcga aggtggccgc ggcggccgag      1020
     caggtgttca tcaccgccgc cgtcgccgag gacgtgcccg aggagctgga cgccgcgcgg      1080
     ttccacgtcg gccacgggga ggtgcggcgt gactga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page