(data stored in ACNUC7421 zone)

EMBL: CP001630.PE40

CP001630.PE40        Location/Qualifiers
FT   CDS_pept        complement(44172..45191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0040"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bja:bll4878 copper export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34014"
FT                   /db_xref="GOA:C6WCJ3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ3"
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /protein_id="ACU34014.1"
FT                   /translation="MTADRTSGPARPRARVAGGLLLGALAGVLVGLAIAGTGAAVGGPG
FT                   IAALVAQPLARVLLDLSATGVVGLSLLPRLLGAARPSATEPVLRLARPAAVVLSAVWAL
FT                   VALLSVVLRAHETRPDVPLTTARLLDYVQRVPAGQGLLFSAVCAVVCLGVGAVAVRRGE
FT                   AVPAELRVLVALFGLLPLPATGHASNRDFRDVAVVAMELHVLGAALWTGGLVALVVLVA
FT                   HRRGLLAEALPRFSRLATAALLVVTATGIGTGLLELAAAPGGGLPGSLVTTPYGLLLVG
FT                   KALCALALAGLGARIRWWLLPLVRRHRPTALVGWAAAELAVMGAAFGLAVVLSRAPVA"
     gtgaccgccg accggaccag cggccccgcc cgcccccgtg cgcgggtggc gggcgggctg        60
     ctgctgggcg cgctcgccgg cgtgctcgtc gggctcgcga tcgcgggcac cggcgcggcg       120
     gtcggcgggc cggggatcgc cgcgctggtg gcgcagccgc tcgccagggt cctgctcgac       180
     ctctcggcga ccggcgtggt cggcctgtcg ctgctgccga ggctgctggg cgcggcccgc       240
     ccctcggcga ccgagccggt gctgcggctg gccaggcccg ccgccgtggt gctgtcggcg       300
     gtgtgggcgc tcgtcgcgct gctgtcggtc gtgctgcgcg cgcacgagac caggccggac       360
     gtgccgctga ccacggcccg gctgctcgac tacgtccagc gggtgcccgc aggccagggg       420
     ctgctgttca gcgcggtgtg cgcggtggtg tgcctggggg tcggcgcggt cgcggtgcgc       480
     aggggcgagg cggtgcccgc cgagctgcgg gtgctggtcg ccctgttcgg gctgctcccg       540
     ctgcccgcca ccgggcacgc gtcgaaccgg gacttccggg acgtggccgt ggtcgcgatg       600
     gagctgcacg tgctgggcgc ggcgctgtgg accggcgggc tggtcgcgct ggtcgtgctc       660
     gtggcgcacc gcagggggct gctggccgag gcgctccccc ggttctccag gctggcgacc       720
     gccgcgctgc tggtggtgac cgcgaccggg atcggcaccg ggctgctgga gctggccgcc       780
     gcgccgggcg gcgggctgcc gggctcgctg gtcaccaccc cgtacgggct gctgctggtc       840
     ggcaaggcgc tgtgcgcgct ggcgctcgcc gggctcgggg cgcgcatccg ctggtggctg       900
     ctgccgctcg tccggcggca ccggccgacc gcgctggtcg gctgggcggc ggcggagctg       960
     gccgtgatgg gcgcggcgtt cgggctcgcg gtggtgctct cgcgcgcgcc ggtcgcctag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page