(data stored in ACNUC7421 zone)

EMBL: CP001630.PE400

CP001630.PE400       Location/Qualifiers
FT   CDS_pept        complement(447158..447916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0407"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: pca:Pcar_0607 thiamin biosynthesis protein;
FT                   TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34374"
FT                   /db_xref="GOA:C6WGQ8"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ8"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACU34374.1"
FT                   /translation="MPGLDATQIRRRLADARLYLCTPHRPDLAEFADAALAGGVDVVQL
FT                   REKGMEARQELAALEVLAEACARHGALLAVNDRADVALAAGADVLHLGQDDLPVPLARR
FT                   VVGEEVVIGRSTHDVAQASAAAVEPGVDYFCTGPCWPTPTKPGRPAPGLDLVRAVAGWD
FT                   AARASAAGGPGGLGASGAGRPGAGAPGAGAAPPARPWFAIGGIDRHRLPEVISAGARRV
FT                   VVVRAITESSDPRAAAAWLKIQLSGVPSSP"
     gtgcccggac ttgacgctac ccagatcagg cgcaggctcg ccgacgcccg gctgtacctg        60
     tgcacccccc accggcccga cctggccgag ttcgccgacg ccgcgctcgc gggcggggtg       120
     gacgtcgtgc agttgcgcga gaagggcatg gaggcgcggc aggagctggc cgccctcgag       180
     gtgctcgcgg aggcgtgcgc gcggcacggg gcgctgctcg cggtgaacga ccgggcggac       240
     gtggccctcg ccgccggggc cgacgtgctg cacctcggcc aggacgacct gcccgtcccg       300
     ctggcccggc gggtggtcgg ggaggaggtg gtgatcgggc ggtccacgca cgacgtcgcg       360
     caggcctcgg cggcggcggt cgagccgggc gtggactact tctgcaccgg gccctgctgg       420
     ccgacgccga ccaagcccgg acgtccggcg ccggggttgg acctggtgcg cgcggtcgcc       480
     gggtgggacg cggcccgcgc gagtgcggcg ggcggccctg gcgggcttgg cgcgagtggc       540
     gcgggcaggc ccggcgcggg tgcgcccggc gcgggtgcgg cccctcccgc acggccgtgg       600
     ttcgccatcg gggggatcga tcggcatcgg cttcccgaag tgatctccgc cggggcccgc       660
     cgggtggtgg tcgtgcgcgc catcaccgag tcgagcgacc cccgcgcggc cgccgcctgg       720
     ttgaaaattc aactaagcgg cgtaccctcg tccccgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page