(data stored in ACNUC7421 zone)

EMBL: CP001630.PE401

CP001630.PE401       Location/Qualifiers
FT   CDS_pept        448503..449510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0408"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: azc:AZC_3554 putative glycine oxidase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34375"
FT                   /db_xref="GOA:C6WGQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ9"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ACU34375.1"
FT                   /translation="MARKRVTVLGGGVIGLSIAWRAAQAGFAVAVRDRGSAHAGSWVAG
FT                   GMLAPVSEAWPGDEAVLALGLESIRLWPGFARELGVRLNTAGTLLTAVDAADAAVLDQH
FT                   AAHLAAHGLEFQVLGAAGLREREPGLGPSVRSGLSIPGDLAVSARTLLAALRTACAEAG
FT                   VRFTGAAESEVDGSTTVIAAGAWSAELHPALRDVIHPVKGEILSLLARPGALEAPERTI
FT                   RAQVRGRAVYLVPNETRSGLLVGATQYEAGFDPTVRVRGVLDLLTDAEEVWPALTEYAL
FT                   AETSVGFRAGSRDNTPLIDWLEPGVLAATGHHRNGVLLAPVTARRVVELLGEAA"
     gtggcgcgca agcgagtgac cgtcctcggc ggcggtgtca tcgggttgtc gatcgcctgg        60
     cgggcggctc aggccgggtt cgccgtcgcg gttcgcgatc gggggtccgc gcacgccggg       120
     tcgtgggtcg cgggcgggat gctcgcgccg gtcagcgagg cgtggcccgg tgacgaggcg       180
     gtgctcgcgc tcggcctgga gtcgatccgc ctgtggcccg gcttcgcccg cgagctgggc       240
     gtgcggctca acaccgcggg caccctcctc accgccgtcg acgccgccga cgccgccgtc       300
     ctcgaccagc acgccgcgca cctcgccgcc cacggcctgg agttccaggt gctcggggcg       360
     gccgggctgc gcgagcggga accggggctc ggcccgtccg tccggagtgg actgagcatc       420
     cccggcgacc tcgccgtctc cgcccgcacc ctgctcgccg ccctgcggac cgcctgcgcc       480
     gaggcgggcg tgcgcttcac cggcgccgcc gagtccgaag tggacggttc gaccaccgtc       540
     atcgccgccg gggcctggag cgccgagctg caccccgccc tgcgcgacgt gatccacccc       600
     gtcaagggcg agatcctcag cctcctcgcc cgacccggcg cgctcgaagc gccggagcgc       660
     accatccgcg cccaggtcag gggccgcgcc gtctacctgg tcccgaacga gacccgctcc       720
     ggcctgctcg tcggcgccac ccagtacgag gccgggttcg acccgaccgt ccgcgtgcgc       780
     ggcgtcctcg acctgctcac cgacgccgag gaggtctggc ccgccctcac cgagtacgcg       840
     ctcgccgaga cctccgtcgg cttccgcgcc ggcagccgcg acaacacccc cctgatcgac       900
     tggctcgaac ccggcgtcct cgccgccacc ggccaccacc gcaacggcgt cctgctcgcc       960
     cccgtcaccg cgcgccgcgt cgtggagctg ctcggggagg cggcgtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page