(data stored in ACNUC7421 zone)

EMBL: CP001630.PE403

CP001630.PE403       Location/Qualifiers
FT   CDS_pept        449707..450495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0410"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   rce:RC1_3100 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34377"
FT                   /db_xref="GOA:C6WGR1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR1"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ACU34377.1"
FT                   /translation="MTEPDRIAPAPDPLRIADREFTSRLITGTGGATNLTVLERALRAS
FT                   GTELTTVALRRADGSGGTGVLQLLRRLGIDLLPNTAGCRTAAEAVLTARLAREALGTSW
FT                   VKLEVHADDRTLLPDPVETLDAARRLVADGFTVLPYTNDDPVLALRLEDAGCAAVMPLG
FT                   SPIGTGLGIRNPHNLELIVARASVPVILDAGVGTASDAAVAMELGCAAVLLATAVTRAQ
FT                   DPELMASAMRSAVRAGRWARLAGRAPKRFWAHASSPAPDA"
     atgaccgagc ccgaccgcat cgcgcccgcc cccgacccgc tgcgcatcgc cgaccgcgag        60
     ttcacctccc gcctgatcac cggcaccggc ggcgcgacca acctgaccgt cctcgaacgc       120
     gccctccgcg cctccggcac cgagctgacc accgtcgccc tccgccgcgc cgacggctcc       180
     ggcggcaccg gcgtcctgca gctcctgcgc cgcctcggca tcgacctcct gcccaacacc       240
     gcgggctgcc gcaccgccgc cgaggccgtc ctcaccgccc ggctcgcccg cgaggccctc       300
     ggcacgtcct gggtgaagct ggaggtccac gccgacgacc gcaccctcct cccggacccg       360
     gtcgagacgc tcgacgccgc gcgccgcctc gtcgccgacg gcttcaccgt cctgccctac       420
     accaacgacg acccggtcct ggccctgcgc ctggaggacg cgggctgcgc tgccgtcatg       480
     cccctcggct cgccgatcgg cacgggcctg ggcatccgca acccgcacaa cctggagctg       540
     atcgtcgcca gggcgtcggt cccggtgatc ctcgacgcgg gcgtcggcac cgcctccgac       600
     gccgccgtcg ccatggagct cggctgcgcc gcggtgctgc tcgccacggc cgtgaccagg       660
     gcgcaggacc ccgagctgat ggcctccgcc atgcggtcgg cggtgcgcgc gggcaggtgg       720
     gcgcgcctgg cgggccgggc gccgaagcgg ttctgggcgc acgcgtccag ccctgcgccg       780
     gacgcctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page