(data stored in ACNUC7421 zone)

EMBL: CP001630.PE404

CP001630.PE404       Location/Qualifiers
FT   CDS_pept        450580..450999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0411"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcm:Bcenmc03_5734 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34378"
FT                   /db_xref="GOA:C6WGR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34378.1"
FT                   /translation="MTDLEDATARLYLTIGRLSRLLRRTGSPGLGPGAVSALATLARCG
FT                   PMRLGDLANKEGVAPPTLSRIVATLVEAGYVRREPDPQDGRAWLASPTDEGVAMVSGVR
FT                   SARVQELRARLESLSPEHRDALVGALGALEALVEE"
     gtgaccgacc tggaggacgc caccgcgcgt ttgtacctca cgatcggcag gctttcccgg        60
     ctgctgcgcc ggaccggctc accggggctc ggccccggcg cggtctcggc gctggcgacg       120
     ctggcgcgct gcggcccgat gcggttgggg gacctggcga acaaggaggg cgtcgcgccg       180
     ccgaccctgt ccaggatcgt ggcgacgctc gtcgaggccg ggtacgtgcg cagggaaccg       240
     gacccccagg acggtcgggc ctggctggcc agcccgaccg acgagggggt cgcgatggtg       300
     tccggcgtgc ggtccgcgcg cgtgcaggag ctgagggccc gcctggagtc cctcagcccc       360
     gagcaccgcg acgcgctcgt gggcgcgctc ggcgcgctgg aagccctggt cgaggagtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page