(data stored in ACNUC7421 zone)

EMBL: CP001630.PE405

CP001630.PE405       Location/Qualifiers
FT   CDS_pept        complement(451015..451833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0412"
FT                   /product="O-methyltransferase domain protein"
FT                   /note="PFAM: O-methyltransferase domain protein; KEGG:
FT                   mlo:mll3178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34379"
FT                   /db_xref="GOA:C6WGR3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR3"
FT                   /inference="protein motif:PFAM:PF02409"
FT                   /protein_id="ACU34379.1"
FT                   /translation="MDRVRVALTGAQETMLATLYGRALDSARPHSVLNDGAAAEAVARL
FT                   DYDFPGTGLTMTSAVGVAIRAWQLDRWLRGFLAEHPRATVLHLACGLDTRAHRLSPGPD
FT                   VRWVDVDLPDVVAVREKVLPPPGGDYRLVGASATSPELWESIPDDRPTAVVFEGLSMYL
FT                   SGAEVEGMVRRAVGRFPSGELMFDVYGTIGIRLQKLVPPVRRAGAVLRWGLDDPTGPEA
FT                   WGLKLVESVRSTEMPMLDRLPLAGRVQLRIVGLIPRLRDAGRAVRYRFPA"
     atggatcgag tgcgcgtagc gctcaccgga gcgcaggaaa cgatgctggc cacgctctac        60
     ggacgggcgc tcgacagcgc ccgcccccac tccgtcctga acgacggagc agccgccgag       120
     gccgtcgccc gcctcgacta cgacttcccc ggcaccggcc tgacgatgac ctccgccgtc       180
     ggcgtggcca tccgggcctg gcagctcgac cggtggctgc gggggttcct ggccgaacac       240
     ccacgggcca ccgtcctcca cctcgcctgc ggcctggaca cccgcgccca ccgcctctcc       300
     cccggccccg acgtgcgctg ggtggacgtc gacctgccgg acgtcgtggc ggtgcgggag       360
     aaggtgctcc cgccgccggg cggggactac cggctcgtcg gggcgtccgc gacctcaccc       420
     gagctgtggg agtcgatccc cgacgaccgg ccgaccgcgg tcgtgttcga ggggctgtcg       480
     atgtacctgt ccggcgcgga ggtggagggg atggtgcggc gggccgtcgg gcggttcccg       540
     tccggggagc tgatgttcga cgtctacggg acgatcggca tcaggctgca gaagctcgtg       600
     ccgcccgtcc ggcgggcggg ggcggtgctg cggtgggggc tggacgaccc gaccgggccc       660
     gaggcgtggg ggctgaagct ggtggagtcg gtgcgcagca ccgagatgcc gatgctggac       720
     cggctgcccc tggcggggcg ggtgcagctg aggatcgtcg gcctgatccc gaggctgcgg       780
     gacgccgggc gggcggtgcg ctaccggttc cccgcgtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page