(data stored in ACNUC7421 zone)

EMBL: CP001630.PE407

CP001630.PE407       Location/Qualifiers
FT   CDS_pept        complement(452143..452997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0414"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34381"
FT                   /db_xref="GOA:C6WGR5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34381.1"
FT                   /translation="MVDRSAQHHTAVYKRKLGEVLETCREEAGLSRADAAAVLDCSTSK
FT                   IRMIESGGVAVKTPELRELLTAYNITGERRADIETLGEHARQRRGRTTWGGAVPERLKR
FT                   FFDKEETAVTIDSYSPWVLQGLAQTEAHARAVIQTNSLLSPKDVDRLVQARLARQERLH
FT                   AQDAPKIRWAVDESVLRRPIGGAEVMRAQLEHLAALCRKDIGELRVIPNSVGAHAGCGF
FT                   PFVVLVDAEGNRSVYVENLTDGSWIEDLDRVTRYEITMREIMDCALSTEESLRLVDTVL
FT                   AQL"
     atggtggaca ggtctgcgca gcaccacacg gcggtctaca agcgcaagct cggcgaggtg        60
     ctggagacgt gccgcgagga ggccggcctg agccgcgcgg acgccgccgc ggtcctcgac       120
     tgctcgacct cgaagatccg gatgatcgag agcggcgggg tcgcggtcaa gacgcccgaa       180
     ctgcgcgagc tgctgaccgc ctacaacatc accggcgagc gccgcgccga catcgagacc       240
     ttgggcgagc acgcccgcca gcgccgtggg cggaccacct ggggcggcgc ggttcccgaa       300
     cgcctgaagc ggttcttcga caaggaggaa accgccgtca cgatcgattc ctactcacca       360
     tgggttctgc aagggctggc gcaaaccgag gcgcacgccc gcgccgtcat ccaaacgaac       420
     tctttgctga gtcccaagga cgtcgaccgg ctcgtgcaag cacgactcgc ccgacaagag       480
     cgccttcacg cccaggacgc cccgaaaatc cgatgggcgg ttgacgagtc ggtcttgcgc       540
     aggccgatcg gcggcgcgga agtgatgcga gcgcagttgg aacacctggc ggccctctgc       600
     cgcaaggaca tcggggaact gcgcgtgatc cccaactccg tcggcgcgca cgcgggttgc       660
     ggattccctt ttgtcgtact cgtggacgcc gaggggaatc gatccgtgta cgtcgagaac       720
     ctgaccgacg gttcatggat tgaagatctc gatcgagtga cacgctacga aatcaccatg       780
     agggagatca tggattgtgc actctcgacc gaggagtcac tgcgactggt cgatacggta       840
     ctagcgcaac tgtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page