(data stored in ACNUC7421 zone)

EMBL: CP001630.PE41

CP001630.PE41        Location/Qualifiers
FT   CDS_pept        complement(45188..45736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0041"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bra:BRADO4155 copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34015"
FT                   /db_xref="GOA:C6WCJ4"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ4"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACU34015.1"
FT                   /translation="MRRAVSLLLSALVAGGVALGAAPAAWAHNVLISSDPKDGAELATG
FT                   PREVTLTFDQPVQAGERFNTLTVTSADGTRWEDQAEPTVRDNSVIFPVRELGPAGEYTL
FT                   GYRILSADGHPVSGSLKFTTTTAAQGTPVPASESATRDASGGDSGGGVPVWVWIVGAVV
FT                   LLGGGVFFALRGGGDGADR"
     atgaggcgcg cggtctcgct gctgctgtcc gcgctcgtgg cgggaggggt cgcgctcggc        60
     gcggccccgg ccgcgtgggc gcacaacgtg ctgatctcca gcgacccgaa ggacggcgcc       120
     gagctggcca ccgggccgcg cgaggtcacg ctgaccttcg accagccggt gcaggcgggc       180
     gagcggttca acacgctcac cgtcacctcg gccgacggca cccgctggga ggaccaggcc       240
     gagccgaccg tgcgggacaa ctcggtgatc ttcccggtgc gcgagctggg cccggcgggc       300
     gagtacaccc tcggctaccg catcctgtcc gccgacgggc acccggtgag cggctcgctg       360
     aagttcacca ccacgacggc ggcgcagggc accccggtgc ccgcctcgga gtccgcgacc       420
     cgggacgcct cgggtgggga ctccggcggc ggtgtgcccg tctgggtgtg gatcgtcggc       480
     gcggtcgtgc tgctcggcgg cggcgtcttc ttcgcgctgc gcggcggagg ggacggcgcc       540
     gaccggtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page