(data stored in ACNUC7421 zone)

EMBL: CP001630.PE410

CP001630.PE410       Location/Qualifiers
FT   CDS_pept        453617..453964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34384"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34384.1"
FT                   /translation="MTDHPSRVPSRGGGARARLAREARSHAPRMYAIAYEAADGGGGGI
FT                   AAYGLQFADRAETVGVADGHRSSSETAAHARALYARFGAPDDLTAHLVWLDATAPVRPA
FT                   PARRPRTARRR"
     gtgaccgacc acccgtcccg cgtcccgtcc cgcggcgggg gcgcccgcgc ccggctcgcg        60
     cgcgaggcgc gctcccacgc gcccaggatg tacgccatcg cctacgaggc cgctgacggc       120
     ggtggtggcg ggatcgcggc ctacggcctc cagttcgccg accgcgccga gaccgtgggc       180
     gtggcggacg gccaccggag cagctccgag accgccgccc acgccagggc cctctacgcc       240
     cggttcggcg cgcccgacga cctcacggcg cacctggtgt ggctcgacgc caccgccccg       300
     gtcagacctg cgcctgcccg ccgtccgcga acagctcgac gccggtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page