(data stored in ACNUC7421 zone)

EMBL: CP001630.PE411

CP001630.PE411       Location/Qualifiers
FT   CDS_pept        complement(453918..454655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0418"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bph:Bphy_4607 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34385"
FT                   /db_xref="GOA:C6WGR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34385.1"
FT                   /translation="MPGVLQDKVAVITGGSSGIGLAMAHRFAAEGARVFVTGRDAARLD
FT                   AAVAEIGDAATGVRADVADPAALDALYERVRAEAGRVDVLVANAGLAADAPLGEHTEEG
FT                   VDLTLAVNVKGTLFTVQKALPLLSAGASIIVIGSSNSTRPNPLLAVYSASKAAVRNLVR
FT                   NWAAQSKDRQFRINVLSPGPTRTPGLMSAGGPMIEQYVREQVPLGRMAEPEEIASAALF
FT                   LASDASSFVTGVELFADGGQAQV"
     atgccgggcg tgttgcagga caaggtggcc gtgatcaccg ggggctccag cgggatcggg        60
     ctggccatgg cccaccggtt cgccgccgag ggcgcgcggg tcttcgtcac cgggcgggac       120
     gccgcgcggc tcgacgccgc cgtcgccgag atcggggacg ccgccaccgg ggtgcgggcc       180
     gacgtcgccg acccggccgc gctggacgcg ctctacgagc gggtgcgggc cgaggccggg       240
     cgggtcgacg tgctggtcgc gaacgcgggc ctggcggccg acgccccgct cggcgagcac       300
     accgaggagg gcgtcgacct caccctcgcg gtgaacgtga agggcacgct gttcaccgtc       360
     cagaaggcgc tgccgctgct gtcggcgggc gcgtcgatca tcgtgatcgg gtccagcaac       420
     agcacccggc ccaacccgct cctcgcggtg tacagcgcgt ccaaggccgc ggtgcggaac       480
     ctggtgcgca actgggcggc gcagtcgaag gaccggcagt tccggatcaa cgtgctcagc       540
     cccggcccca cccgcacgcc cggcctgatg agcgcgggcg ggccgatgat cgagcagtac       600
     gtgcgggagc aggtgccgct ggggcggatg gccgagccgg aggagatcgc gtcggcggcg       660
     ctgttcctgg cctcggacgc ctcctcgttc gtcaccggcg tcgagctgtt cgcggacggc       720
     gggcaggcgc aggtctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page