(data stored in ACNUC7421 zone)

EMBL: CP001630.PE412

CP001630.PE412       Location/Qualifiers
FT   CDS_pept        454677..455330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0419"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1146
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34386"
FT                   /db_xref="GOA:C6WGS0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34386.1"
FT                   /translation="MDRPKPSRLWTIESRTGSFGAVPRPRKFDETQVLELAREQFWTTG
FT                   FAGTRMDDIARVTGLGKGSLYGAFGDKEALFRRVFDDWCGAIVVLAEENLTGPDEGALA
FT                   RLEAYVRFVAANTAADVGRRGCFQAKGTAELAASDESVADRSATTMRALLGLLSREITA
FT                   AQRCGDLAPDADPDALASLLLVVVRGVEAVGKAGLGAEAVTSAADTALALLPRP"
     atggatcgtc caaaacctag ccggttgtgg acgatcgagt caagaacggg tagtttcggc        60
     gccgtgccga ggcccaggaa gttcgacgag acgcaggtgc tggagctggc gcgggagcag       120
     ttctggacca ccgggttcgc gggcacgcgc atggacgaca tcgcccgcgt cacgggcctg       180
     ggcaagggca gcctctacgg ggcgttcggc gacaaggagg ccctgttccg ccgcgtcttc       240
     gacgactggt gcggggcgat cgtcgtcctg gccgaggaga acctgaccgg cccggacgag       300
     ggcgcgctcg cccggctgga ggcctacgtc cgcttcgtcg ccgcgaacac cgccgccgac       360
     gtcgggcgcc ggggctgctt ccaggccaag gggaccgccg agctggccgc gtccgacgag       420
     tccgtcgccg accgctcggc caccaccatg cgcgcgctgc tcgggctgct gagccgcgag       480
     atcaccgccg cccagcgctg cggcgacctc gcccccgacg ccgacccgga cgcgctggcg       540
     tcgctgctgc tggtggtggt ccggggcgtc gaggcggtcg ggaaggcggg cctgggcgcg       600
     gaggccgtga ccagcgcggc ggacaccgcg ctggcgctcc tgcccaggcc ctag             654
//

If you have problems or comments...

PBIL Back to PBIL home page