(data stored in ACNUC7421 zone)

EMBL: CP001630.PE413

CP001630.PE413       Location/Qualifiers
FT   CDS_pept        complement(455336..456040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0420"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0002869 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34387"
FT                   /db_xref="GOA:C6WGS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0002869"
FT                   /protein_id="ACU34387.1"
FT                   /translation="MSTPTVVLVHGAFADSSSWTDVVRGLRAQGVPVVAVANPLRGLES
FT                   DARYVASVANSVTGPVVLVGHSYGGALITRAARDVAGAKALVYVAAFQPDTGESALELA
FT                   NRFPGAKLGPDTLDVLVHEGAPELSIKPGDFREVFAADLPESATTVLAATQRPVAEAAL
FT                   AGGLDGEPAWRSLPSWALVANQDNAIPAASQEFMAERAGSTTTRVDASHAVAVSRPEVV
FT                   AELVLAAVRATS"
     atgagcaccc ccaccgtcgt cctggtccac ggcgcgttcg ccgactcgtc cagctggacc        60
     gacgtcgtcc gcgggctgcg cgcccagggc gtcccggtcg tcgcggtcgc gaacccgctg       120
     cgcggcctgg agtccgacgc ccgctacgtc gcctcggtcg ccaacagcgt caccggcccg       180
     gtcgtgctgg tcggccactc ctacggtggc gcgctgatca cccgcgcggc gcgggacgtc       240
     gcaggcgcga aggcgctggt ctacgtcgcg gcgttccagc ccgacaccgg cgagagcgcg       300
     ctggagctgg cgaaccgctt ccccggcgcc aagctcggcc cggacaccct ggacgtgctc       360
     gtgcacgagg gcgcgccgga gctgtcgatc aagccggggg acttccgcga ggtgttcgcg       420
     gccgacctgc cggagagcgc gacgaccgtg ctggccgcga cccagcgccc ggtggccgag       480
     gccgcgctgg cgggtgggct cgacggcgag cccgcgtggc gctcgctgcc gtcgtgggcg       540
     ctggtcgcga accaggacaa cgcgatcccg gcggcctcgc aggagttcat ggccgagcgc       600
     gccgggtcga ccacgacgcg ggtcgacgcc tcgcacgcgg tcgcggtgtc ccggccggag       660
     gtggtggccg agctggtgct cgcggcggtg cgcgccacga gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page