(data stored in ACNUC7421 zone)

EMBL: CP001630.PE415

CP001630.PE415       Location/Qualifiers
FT   CDS_pept        complement(456953..457957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0422"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   cak:Caul_0434 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34389"
FT                   /db_xref="GOA:C6WHT8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT8"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU34389.1"
FT                   /translation="MTGTMKAVRLHEHGGPEVLRLDEVPVPEVGPGEVRVRVRAVGLNP
FT                   PDWYLREGMTKIPPELRPRLDLPLIPGTDVSGVVEEVGEGAGWAVGDEVFGMLRFPSPG
FT                   GSAYAEQVVAPATDLARKPAGVDHVQAAGAPMAGLTAWQFLIALGHEVAPPFQPRPHHP
FT                   VPLGSGTTVLVNGAAGGVGHFAVQLARWRGARVVAVASGSHGEFLRGLGADVVVDYTRE
FT                   RAEDLVDEVDLVLDAVGGEATGRFLPLVRRGGALFPVFPGPYDVAEAARREVTVSATQV
FT                   RASGAQLAELGALLGSGEVRVGVDSVFPLADAAAAHARAERGHIRGKIVLVVD"
     atgaccggca cgatgaaggc ggttcggctg cacgagcacg gcgggccgga ggtgctgcga        60
     ctcgacgagg tcccggtgcc cgaggtgggg ccgggcgagg tccgggtgcg ggtgcgggcg       120
     gtggggctca acccgccgga ctggtacctg cgggagggca tgacgaagat cccgccggag       180
     ctgcggccga ggctggacct tccgctgatc cccggcacgg acgtgtccgg ggtggtggag       240
     gaggtcggcg agggcgcggg gtgggccgtc ggggacgagg tgttcgggat gctgcgcttc       300
     ccctcgcccg gcggcagcgc gtacgccgag caggtggtgg cgcccgcgac ggacctggcc       360
     cgcaagcccg cgggcgtgga ccacgtgcag gcggcgggcg cgccgatggc ggggctgacc       420
     gcgtggcagt tcctgatcgc gctcgggcac gaggtcgcgc cgccgttcca gccgcgaccg       480
     caccacccgg tcccgctcgg gtcggggacg acggtgctgg tcaacggcgc ggcgggcggc       540
     gtggggcact tcgcggtgca gctggccagg tggcggggcg cgcgggtggt cgcggtggcc       600
     tcggggtcgc acggggagtt cctgcggggg ctgggcgcgg acgtggtcgt ggactacacg       660
     cgggagcgcg ccgaggacct ggtcgacgag gtcgacctgg tgctggacgc ggtcggcggg       720
     gaggcgaccg ggcggttcct gccgctggtc cggcgcgggg gcgcgctgtt cccggtgttc       780
     cccggcccgt acgacgtggc cgaggcggcg cggcgcgagg tgaccgtctc ggccacgcag       840
     gtcagggcga gcggggcgca gctggcggag ctgggcgcgc tgctggggtc gggcgaggtg       900
     cgggtcgggg tcgacagcgt cttcccgctc gcggacgccg ccgccgcgca cgcgcgggcg       960
     gagcgcgggc acatccgggg caagatcgtg ctggtggtgg actag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page