(data stored in ACNUC7421 zone)

EMBL: CP001630.PE416

CP001630.PE416       Location/Qualifiers
FT   CDS_pept        458084..458638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0423"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cak:Caul_0435
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34390"
FT                   /db_xref="GOA:C6WHT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34390.1"
FT                   /translation="MRADARKNRDHLLAIADAVITEQGADVSMRDLARRAEVGLATLLR
FT                   HFPTRDALLDALLRAGFDELTTLADRLEARLPPGEALKAWLREFVACAHTYRGAVTTMM
FT                   GAIEDPDSALHASCVAMRGSGARLLERAQAAGQARTDLTGPDLFALGGALIWLHDQPTS
FT                   APRADHLLDVVAAAILTPEKP"
     atgcgggcgg acgccaggaa gaaccgcgac cacctgctcg cgatcgcgga cgcggtcatc        60
     accgagcagg gcgcggacgt gtcgatgcgc gacctcgcgc gccgcgccga ggtcggcctc       120
     gcgaccctgc tgcgccactt cccgaccagg gacgcgctgc tggacgccct gctccgcgcg       180
     ggcttcgacg agctgaccac cctcgcggac cggctggagg cgcgcctgcc ccccggcgag       240
     gcgctcaagg cgtggctgcg cgagttcgtc gcctgcgcgc acacctaccg gggcgccgtc       300
     acgaccatga tgggcgccat cgaggacccg gactccgcgc tgcacgcctc ctgcgtcgcg       360
     atgcgcggct ccggcgcccg gctgctggag cgcgcccagg ccgcgggcca ggccaggacc       420
     gacctgaccg gccccgacct gttcgcgctc ggcggggccc tcatctggct gcacgaccag       480
     cccacgtccg cgccccgcgc cgaccacctg ctcgacgtgg tcgccgccgc gatcctgacc       540
     ccggagaagc cgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page