(data stored in ACNUC7421 zone)

EMBL: CP001630.PE417

CP001630.PE417       Location/Qualifiers
FT   CDS_pept        complement(458684..459514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0424"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: sfu:Sfum_1692
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34391"
FT                   /db_xref="GOA:C6WHU0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU0"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACU34391.1"
FT                   /translation="MERPSVVETPKKVLTIAGSDSGGGAGLQADLRVLAACGVHGMTAV
FT                   TAVTVQNSLGVSGVVEIPAEQVAAQIRVVATDIGVDAAKTGMLASAPIIEAVAAACDEV
FT                   GIGSGGTPFVVDPVSASMHGDPLLTDAALEALRVLLFPRATLVTPNLDEVRLLTGVDVR
FT                   TREEQREVAKVLHGMGPQWVLVKGGHMRGDPECLDLLYDGREFHEYVGPRYDVLHTHGS
FT                   GDTLASSICSRLARGVGVVDAVRFGKDFVVRSVLAAYPLGAGVGPVSPLWRLAE"
     gtggagcggc cgagcgtcgt ggagacgccg aagaaggtcc tgaccatcgc gggttccgac        60
     tcgggcggtg gcgcggggtt gcaggccgac ctgcgggtgc tggcggcgtg cggggtgcac       120
     ggcatgaccg ccgtgaccgc cgtgacggtg cagaactcgc tgggcgtgag cggcgtcgtg       180
     gagatcccgg ccgagcaggt cgcggcgcag atcagggtgg tggccaccga catcggcgtg       240
     gacgcggcca agaccgggat gctcgcgtcg gcgccgatca tcgaggcggt ggcggcggcg       300
     tgcgacgagg tcggcatcgg ctcgggcggg acgccgttcg tggtggaccc ggtgtcggcg       360
     tccatgcacg gcgacccgct gctgaccgac gccgcgctgg aggcgctgcg ggtcctgctg       420
     ttcccgaggg cgacgctggt gacgccgaac ctggacgagg tgcggctgct gaccggggtc       480
     gacgtgcgca cccgcgagga gcagcgcgag gtcgcgaagg tgctgcacgg catgggcccg       540
     cagtgggtgc tggtcaaggg cgggcacatg aggggcgacc cggagtgcct ggacctgctg       600
     tacgacgggc gggagttcca cgagtacgtg gggccccggt acgacgtgct gcacacgcac       660
     ggcagcgggg acacgctggc gtcgtccatc tgctcgcgcc tggcgcgcgg ggtgggggtg       720
     gtcgacgcgg tgcggttcgg gaaggacttc gtggtccggt cggtgctggc ggcgtacccg       780
     ctgggcgccg gggtcgggcc ggtgtcgccg ctgtggcggc tcgccgagtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page