(data stored in ACNUC7421 zone)

EMBL: CP001630.PE418

CP001630.PE418       Location/Qualifiers
FT   CDS_pept        complement(459516..461159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0425"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: bsu:BSU08790
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34392"
FT                   /db_xref="GOA:C6WHU1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU1"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACU34392.1"
FT                   /translation="MTALGDGSVRPSVTTGPIRGSRKVHRDAEDGVRVPFRRVELTDGD
FT                   HFDLYDTSGPYTAGDVDVREGLEKIRAGWISAREPVNGAATQLAWARAGVITPEMRFAA
FT                   LRESLAPEFVRDEVAAGRAVIPANRNHPESEPMVIGKGFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREWIIRNSPVPVGTVPIYQALEKVGGDPAALS
FT                   WEVYRDTVVEQAEQGVDYMTVHAGVLLRYVPLTARRVTGIVSRGGSIMAAWCLAHHEES
FT                   FLYTRFAELCEILRQYDVTFSLGDGLRPGSIADANDEAQFAELRTLGELARVARAHDVQ
FT                   VMIEGPGHVPLHKIAENVRLEQEWCDGAPFYTLGPLATDVAPAYDHITSAIGAAQIGAL
FT                   GTAMLCYVTPKEHLGLPDRDDVKTGVITYKIAAHAADLAKGHPGAQAWDDALSRARFEF
FT                   RWEDQFNLSLDPDTAREFHDRTLPAEPAKTAHFCSMCGPKFCSMRITQDVRRYAEERGL
FT                   STVEAIEAGMAEKAHEFDDRGGKVYLPVVD"
     gtgacggcac tcggggacgg ctcggtcagg ccgagcgtca ccaccgggcc gatccggggg        60
     tcccgcaagg tccaccgcga cgcggaggac ggcgtgcggg tcccgttccg cagggtcgag       120
     ctcaccgacg gcgaccactt cgacctgtac gacacctccg ggccttacac ggccggggac       180
     gtcgacgtgc gcgagggact ggagaagatc cgcgccggct ggatctcggc gcgcgagccc       240
     gtgaacgggg cagccaccca gctggcctgg gcgcgggcgg gcgtgatcac cccggagatg       300
     cggttcgcgg cgctgcgcga gtcgctggcg ccggagttcg tgcgcgacga ggtcgccgcg       360
     gggcgcgcgg tgatcccggc caaccgcaac cacccggagt ccgagccgat ggtcatcggc       420
     aaggggttcc tggtgaaggt caacgccaac atcggcaact cggcggtgac ctcgtccgtc       480
     gaggaggagg tggagaagat ggtgtgggcg acccgctggg gcgccgacac cgtgatggac       540
     ctgtcgaccg gcaagcgcat ccacgagacc cgcgagtgga tcatccgcaa ctcgccggtc       600
     cccgtgggga cggtgccgat ctaccaggcg ctggagaagg tcggcgggga tccggccgcg       660
     ctgtcctggg aggtgtaccg ggacaccgtc gtggagcagg ccgagcaggg cgtggactac       720
     atgacggtgc acgcgggcgt gctgctgcgg tacgtgccgc tgacggcgcg gcgggtcacc       780
     gggatcgtct cgcgcggcgg ctcgatcatg gccgcgtggt gcctggcgca ccacgaggag       840
     agcttcctgt acacccggtt cgccgagctg tgcgagatcc tgcgccagta cgacgtgacg       900
     ttctcgctgg gcgacgggct gcggccgggg tcgatcgcgg acgccaacga cgaggcccag       960
     ttcgccgagc tgcgcaccct gggcgagctg gcgcgggtgg ccagggcgca cgacgtgcag      1020
     gtgatgatcg aggggcccgg ccacgtgccg ctgcacaaga tcgcggagaa cgtgcggctg      1080
     gagcaggagt ggtgcgacgg cgcgccgttc tacacgctcg gcccgctggc caccgacgtc      1140
     gcgcccgcct acgaccacat cacgtcggcg atcggcgcgg cgcagatcgg ggcgctcggc      1200
     acggccatgc tctgctacgt gaccccgaag gagcacctgg ggctgccgga ccgggacgac      1260
     gtgaagaccg gcgtgatcac gtacaagatc gccgcgcacg ccgccgacct cgccaagggc      1320
     caccccggcg cgcaggcgtg ggacgacgcg ctgtccaggg ccaggttcga gttccgctgg      1380
     gaggaccagt tcaacctctc gctcgacccg gacaccgcgc gcgagttcca cgaccggacg      1440
     ctcccggcgg agcccgcgaa gacggcgcac ttctgctcga tgtgcgggcc gaagttctgc      1500
     tcgatgcgga tcacgcagga cgtgcggcgc tacgctgagg agcggggtct gtccactgtg      1560
     gaagcgattg aggcgggtat ggccgagaag gcgcacgagt tcgacgaccg gggcggcaag      1620
     gtctacctgc cggtcgtgga ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page