(data stored in ACNUC7421 zone)

EMBL: CP001630.PE419

CP001630.PE419       Location/Qualifiers
FT   CDS_pept        461485..462102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34393"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34393.1"
FT                   /translation="MWLLDWQELLSAEQLAEGGSGERELAERVLADPVGRHAWTCVDWA
FT                   MTLVTCSQCGAEPTAGPWDCVRCAVTESARWQWDHTATPGAITPAEHALRAARAALRAP
FT                   HRRRSPVVDAWRLLLPFLVAGHGATSADVSRLRAQVIGGSYAELAACGSAVELTGFVEL
FT                   PWRRTSPTGDHQPQPQPHRRRPRQQLEAAPDAGAPQVAPDPV"
     gtgtggctgc tggactggca ggagctgctg tccgccgagc agctggccga gggcggttcg        60
     ggggagcgcg agctggccga gcgggtgctg gccgacccgg tgggcaggca cgcgtggacg       120
     tgcgtggact gggcgatgac cctggtgacc tgctcgcagt gcggcgccga gccgaccgcg       180
     ggtccgtggg actgcgtccg ctgcgcggtg accgagtcgg cccgctggca gtgggaccac       240
     accgcgacgc cgggcgcgat caccccggcc gagcacgccc tgcgcgccgc cagggccgcg       300
     ctgcgcgccc cgcaccgcag gcgctccccg gtggtggacg cctggcggct gctgctgccg       360
     ttcctggtgg cgggccacgg cgcgacgtcg gcggacgtgt cgcggctgcg cgcccaggtc       420
     atcggcggct cgtacgccga gctggccgcg tgcggcagcg ccgtcgagct gaccggcttc       480
     gtcgagctcc cgtggcgccg cacgtcaccc accggcgacc accagccgca gccccagccc       540
     caccggcgcc gcccccggca gcagctggag gccgcgccgg acgcgggggc gccgcaggtg       600
     gcgcccgacc cggtctag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page