(data stored in ACNUC7421 zone)

EMBL: CP001630.PE42

CP001630.PE42        Location/Qualifiers
FT   CDS_pept        complement(45733..46482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0042"
FT                   /product="nuclear export factor GLE1"
FT                   /note="PFAM: nuclear export factor GLE1; KEGG: sme:SMa1200
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34016"
FT                   /db_xref="GOA:C6WCJ5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ5"
FT                   /inference="protein motif:PFAM:PF07987"
FT                   /protein_id="ACU34016.1"
FT                   /translation="MSTTRTGLRPLVRAGALLTTAGFLALGTAGTASAHVSASTTAPAT
FT                   QGGYAKVIFRVPNERPDSGTVKLEVTLPAEYPLASVSTKPLPGWQVEAVKATLDKPVTS
FT                   HGREVTEAVRTVVWTADAGVQIAPGQFNEFEVSVGPLPDTTEQLVMPAKQTYASGEVVD
FT                   WSAPPADEEPEHPAPVLKLVKPAEGADSHGNAPAGSGDSHSETAASTTTDDTARWLGGA
FT                   GLAVGALGLGLGAGAVLRTRRSGKPSA"
     atgtccacca ctcgcaccgg cctgcgcccg ctcgtccgcg caggcgcact cctcaccacc        60
     gcgggcttcc tcgcgctcgg cacggcgggc accgcctccg cgcacgtctc cgcgtcgacc       120
     accgccccgg ccacccaggg cggctacgcg aaggtcatct tccgcgtgcc gaacgagcgc       180
     cccgactccg gcacggtcaa gctggaggtc accctccccg ccgagtaccc gctggcctcg       240
     gtcagcacga agccgctgcc cggctggcag gtcgaggcgg tcaaggccac gctcgacaag       300
     ccggtcacca gccacggccg cgaggtcacc gaggccgtcc gcaccgtggt gtggaccgcc       360
     gacgcgggcg tgcagatcgc gcccggtcag ttcaacgagt tcgaggtgtc ggtcggcccg       420
     ctgcccgaca ccaccgagca gctggtcatg cccgcgaagc agacctacgc cagcggcgag       480
     gtcgtcgact ggagcgcccc gcccgccgac gaggagcccg agcaccccgc gccggtgctg       540
     aagctggtca agcccgccga gggcgccgac tcgcacggca acgcccccgc cgggtccggg       600
     gactcgcact ccgagaccgc cgcgtccacg accaccgacg acaccgcccg ctggctgggc       660
     ggcgcgggcc tcgcggtcgg tgcgctcggc ctcggcctcg gcgcgggcgc cgtcctgcgc       720
     acccgccgct cgggcaagcc ctcggcatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page