(data stored in ACNUC7421 zone)

EMBL: CP001630.PE420

CP001630.PE420       Location/Qualifiers
FT   CDS_pept        complement(462297..462884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0427"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pmr:PMI2825 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34394"
FT                   /db_xref="GOA:C6WHU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU3"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACU34394.1"
FT                   /translation="MAVHPIRIAGDPVLHNPTRPVDEHDDELRALIADMYETMAAANGV
FT                   GLAANQIGVDLRLFVYDCPDDEGVRRRGEVVNPVLQTSDVPLGMPDPDDDYEGCLSAPG
FT                   ESYPTGRASWAKVTGTDGNGDPVEVEGTGFFARCLQHETDHLDGYLYLDRLVGRHKRAS
FT                   KKMIKANGWGVPGLSWDPATSEDPFADDEDED"
     atggcagtac accccatccg gatcgcgggc gacccggtcc tgcacaaccc gacccgtccc        60
     gtggacgagc acgacgacga gctcagggcg ctcatcgcgg acatgtacga gacgatggcc       120
     gccgccaacg gcgtcggcct cgcggccaac cagatcggcg tggacctccg gctgttcgtc       180
     tacgactgcc cggacgacga gggggtgcgg cgccggggcg aggtggtgaa cccggtgctc       240
     cagacctcgg acgtcccgct ggggatgccg gacccggacg acgactacga gggctgcctc       300
     tcggcgcccg gcgagtccta cccgaccggg cgcgcgtcct gggcgaaggt caccgggacc       360
     gacgggaacg gggacccggt ggaggtcgag gggaccgggt tcttcgcccg gtgcctccag       420
     cacgagacgg accacctgga cgggtacctg tacctggacc ggctggtggg tcggcacaag       480
     cgggcctcca agaagatgat caaggccaac gggtggggcg tccctgggct gtcctgggac       540
     ccggccacct cggaggaccc gttcgcggac gacgaggacg aggactga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page