(data stored in ACNUC7421 zone)

EMBL: CP001630.PE421

CP001630.PE421       Location/Qualifiers
FT   CDS_pept        463048..463332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34395"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34395.1"
FT                   /translation="MDAALAHPAAPGGLDGREREILAFERQWWKYAGAKEQAVRELFDL
FT                   TPTRYYQLLNALIEKEEALAADPMLVKRLLRLRSGRRRARAARRLGVDG"
     atggacgccg cactcgcgca ccccgcagcc cctggcgggc tcgacgggcg ggagcgcgag        60
     atcctggcct tcgagcgcca gtggtggaag tacgcgggcg ccaaggagca ggccgtccgc       120
     gagctgttcg acctcacgcc cacccgctac taccagctac tcaacgcgtt gatcgagaag       180
     gaggaggccc tcgcggccga tccgatgctc gtcaagcggc tgctccggtt gcgatcgggc       240
     aggcggcggg ctcgggcggc taggcgcctg ggcgtggacg gatga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page