(data stored in ACNUC7421 zone)

EMBL: CP001630.PE422

CP001630.PE422       Location/Qualifiers
FT   CDS_pept        463329..463991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34396"
FT                   /db_xref="GOA:C6WHU5"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34396.1"
FT                   /translation="MSNPESSGSAQPARAAGYALLGLAGVALVLGVVTLFTGSDDDPQA
FT                   QQQQPAPSASAPAEPGPSSEPPAGEPSASEPPASESAGAPTTTTGQPPATTTEQQPQPQ
FT                   PPAQQPGDQSQGTPATRPSVRVYNNSNISGLAARASDDIGKSGWAVQATGNYPDGIIET
FT                   TTVYYRAGTAEEDAAKQLAQSIRARVMPRFDGIKDAHDGVIVIVTNDYQGPGGKAGS"
     atgagcaacc ccgagtcctc aggttcggcc caacccgccc gcgccgcggg ctacgccctg        60
     ctcggcctcg ccggggtggc gctggtgctc ggcgtcgtga cgctgttcac cgggtcggac       120
     gacgatccgc aggcgcagca gcagcaaccc gccccgagcg cctccgcgcc cgccgaaccg       180
     ggcccctcca gcgagccgcc cgccggtgag ccgagcgcga gcgagccgcc cgcgagcgag       240
     tccgcgggcg cgccgacgac caccaccggg cagccgcccg cgacgacgac ggagcagcag       300
     ccccagccgc agcccccggc gcagcagccc ggcgaccagt cgcagggcac acccgccacc       360
     cggccctcgg tgcgcgtcta caacaacagc aacatcagcg gtctggccgc gcgcgcgtcc       420
     gacgacatcg gcaagtccgg ctgggcggtc caggccaccg gcaactaccc ggacggcatc       480
     atcgagacca ccacggtcta ctaccgcgcg ggcacggccg aggaggacgc ggccaagcag       540
     ctcgcccagt cgatccgcgc gcgcgtgatg ccccggttcg acggcatcaa ggacgcgcac       600
     gacggcgtca tcgtgatcgt cacgaacgac taccagggac cgggtggcaa ggcgggcagc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page