(data stored in ACNUC7421 zone)

EMBL: CP001630.PE423

CP001630.PE423       Location/Qualifiers
FT   CDS_pept        complement(464055..464762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0430"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   mes:Meso_0568 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34397"
FT                   /db_xref="GOA:C6WHU6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU6"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACU34397.1"
FT                   /translation="MSTQGTVSPARRRGLADEVADRIREGILTGAYEPGRQLREVELST
FT                   VMDVSRGPVREALRLLEHEGLVHVTWHRGATVTRFSRRDVAELDSLRGALECLAVHEVA
FT                   HRATEEDFAALDRAAEALARAVGAHELAQRDVDFHDAVFAAAHHDRLTRSWGCIRRQVH
FT                   LFLLTRISRDEGLRGGCAEEHRELVAALRTRDAATASALLGEHRRRVFELSDDDDWSDL
FT                   LCPDDCGGERREG"
     atgagcaccc agggcaccgt gtcacccgcc cgccgcaggg gtctggccga cgaggtggcc        60
     gaccgcatcc gcgagggcat cctcaccggc gcctacgaac ccggcaggca gctgcgcgag       120
     gtcgagctgt cgaccgtcat ggacgtcagc cggggccccg tccgcgaggc gctgcgactg       180
     ctggagcacg aggggctcgt gcacgtcacc tggcaccggg gcgcgacggt cacccgcttc       240
     tcccgccggg acgtcgccga gctggacagc ctgcgcgggg ccctggagtg cctggccgtg       300
     cacgaggtcg cgcaccgggc caccgaggag gacttcgccg cgctcgaccg ggccgccgag       360
     gcgctggcgc gggccgtcgg ggcgcacgag ctggcgcagc gggacgtcga cttccacgac       420
     gcggtgttcg ccgccgcgca ccacgaccgg ctgacccgct cgtgggggtg catccggcgg       480
     caggtccacc tgttcctgct cacccggatc agccgggacg aggggctgcg cggcgggtgc       540
     gccgaggagc accgggagct ggtcgccgcg ctgcgcaccc gtgacgcggc caccgcgagc       600
     gcgctgctcg gcgagcaccg caggcgggtg ttcgagctgt cggacgacga cgactggtcc       660
     gacctgctgt gcccggacga ctgcgggggc gagcggcgcg aggggtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page