(data stored in ACNUC7421 zone)

EMBL: CP001630.PE424

CP001630.PE424       Location/Qualifiers
FT   CDS_pept        464849..465946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0431"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gme:Gmet_2577 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34398"
FT                   /db_xref="GOA:C6WHU7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU7"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACU34398.1"
FT                   /translation="MSTLFSTLTLRSLDIPNRVWMSPMCTYSAAPSGPEAGVPTDFHLT
FT                   HLASRAAGGAGLVMAEATGVRADGRISPWDLGLWNDAQQEAFARITAAISAHGAVPAIQ
FT                   LAHAGRKASTNKPWLGGGSVADTEHGWQPVGPSPAPFHGLPVPRELTTGEIAALVEDFA
FT                   ASARRALAAGFKVVEVHGAHGYLINSFLSPISNQRTDEYGGTTENRMRFALEVVDAVRA
FT                   VWPEDLPVLFRTSATDWTAEQGGVGWAEDDTVLLAKELQQRGVDLLDVSTGGMAHDAVI
FT                   PVESHYQVRFAAKVREATGLPTGAVGLITEPARAEEVVATGQADAVLLGRELLRDPYWA
FT                   HHAAQELGVDSNWPEQYGYAVRPRR"
     ttgagcaccc tgttcagcac gctgaccctg cgatccctgg acatccctaa ccgggtctgg        60
     atgtccccga tgtgcaccta ctccgccgcc ccctcgggcc cggaggccgg tgtgcccacc       120
     gacttccacc tcacccacct ggccagccgc gccgccggtg gcgcgggcct ggtcatggcg       180
     gaggcgaccg gtgtgcgcgc cgacggccgc atcagcccgt gggacctggg cctgtggaac       240
     gacgcccagc aggaggcgtt cgcccggatc accgccgcga tcagcgccca cggcgcggtc       300
     cccgcgatcc agctcgccca cgcggggcgc aaggcgtcga cgaacaagcc gtggctgggc       360
     gggggttccg tcgccgacac cgagcacggc tggcagccgg tcggccccag cccggcgccg       420
     ttccacggcc tgccggtgcc gcgcgagctg accaccggcg agatcgccgc gctggtggag       480
     gacttcgccg cgtccgcgcg ccgcgccctc gccgcgggct tcaaggtcgt cgaggtgcac       540
     ggcgcccacg gctacctgat caactccttc ctgtccccga tctccaacca gcgcaccgac       600
     gagtacggcg gcacgaccga gaaccggatg cgcttcgcgc tggaggtcgt ggacgcggtg       660
     cgcgcggtgt ggccggagga cctgccggtg ctgttccgca cctcggcgac cgactggacc       720
     gccgagcagg gcggcgtggg ctgggccgag gacgacacgg tgctgctggc caaggagctc       780
     cagcagcgcg gcgtcgacct gctcgacgtg tcgaccggcg gcatggcgca cgacgcggtc       840
     atcccggtgg agtcgcacta ccaggtgcgc ttcgcggcga aggtccgcga ggccaccggc       900
     ctgcccaccg gcgcggtcgg cctgatcacc gagcccgcgc gcgccgagga ggtcgtcgcg       960
     accggccagg ccgacgcggt cctgctgggc cgcgagctgc tgcgcgaccc gtactgggcg      1020
     caccacgcgg cgcaggagct gggcgtggac tcgaactggc cggagcagta cgggtacgcc      1080
     gtgcgcccgc gccgctag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page