(data stored in ACNUC7421 zone)

EMBL: CP001630.PE425

CP001630.PE425       Location/Qualifiers
FT   CDS_pept        466404..468608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0432"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: mrd:Mrad2831_5798 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34399"
FT                   /db_xref="GOA:C6WHU8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU8"
FT                   /inference="protein motif:PRIAM:3.6.4.3"
FT                   /protein_id="ACU34399.1"
FT                   /translation="MITLTARLSPSALDTRRGVVRMHREVLDALGLRQWDAVRLTGARV
FT                   SAALAAAAPDGSPVGVVLVDDITLSNLGVTEGAELVVTPVEVSAARTITVAGSRLASTA
FT                   LTPETLRMALTGKVLTVGDAVSLLPQDLAPPPGADVSATRRKLSAAIGTTWTNELLTIT
FT                   SADPGGVVAVRPSTLVAWRDATAPAPAQAAPPAVDAGITPVTPPPPPAEALPVADLVGQ
FT                   QDAARRLAEWLDLVLTQPELLTRLGAAPRLAALVSGPEGVGKATLVRAVAHAAGTRVVE
FT                   VSAPAIAVLEANATARALADAITQAQSQPGSPAVLVLTDVEALLPAATPPPVATVVLDA
FT                   LRAALAATPLVVTSASPELIDPRLRVPDLVDRELVLPLPDGATRRELLRALLREVPLEP
FT                   DVDLAEVADRTPGFVAADLVAVRREAAVRSALRQRQEAEPRVAQEDLLGSLDTVRPISM
FT                   STSDTLRTGGLTLDDVGDMAEVKQALTEAALWPLQYPDSFARLGVEPPRGLLLYGPPGC
FT                   GKTFLVRALAGTGKLNVLSVKGAELMDKFVGESERAVRELFRRAAEAAPALVFLDEVDA
FT                   LAPRRGQSSDSGVADRVVAALLTELDGVEPLRDVIVLGATNRPELVDPALLRPGRLERL
FT                   VYVPPPDAEARVEILRSASRNTPLAEDVELTALADDLDGYSAADCAALIREAALTAMRE
FT                   SLSATAVTAEHLAKARGVVRPSLDPAQLASLAAYAESRKA"
     gtgatcaccc tgaccgcgag gctctcccca tccgcgctgg acacccgccg cggtgtcgtc        60
     cggatgcacc gcgaagtcct ggacgcgctc ggcctgcgcc agtgggacgc ggtccgcctc       120
     accggcgcgc gggtcagcgc ggccctcgcc gccgcggccc ccgacggcag ccccgtcggc       180
     gtggtgctgg tcgacgacat caccctctcc aacctcggcg tcaccgaggg cgcggagctc       240
     gtcgtcaccc ccgtcgaggt gtccgccgct cgcaccatca ccgtcgcggg ctcccgcctg       300
     gccagcaccg cgctcacccc ggagaccctc cggatggcgc tcaccggcaa ggtcctcacg       360
     gtcggcgacg cggtgtccct gctcccgcag gacctggccc cgccgcccgg cgccgacgtc       420
     tcggccaccc gccgcaagct gtccgccgcc atcggcacga cctggaccaa cgagctgctc       480
     accatcacct ccgccgaccc cggcggcgtg gtggccgtgc gcccctccac gctcgtggcc       540
     tggcgcgacg cgaccgcccc cgccccggcg caggccgccc cgcccgccgt cgacgcgggc       600
     atcaccccgg tcaccccgcc gcccccgccc gccgaggcgc tcccggtcgc cgacctggtc       660
     ggccagcagg acgccgcccg ccgcctcgcc gagtggctcg acctcgtcct cacccagccg       720
     gagctgctca ccaggctcgg cgcggccccc aggctcgccg cgctggtcag cggccccgag       780
     ggggtcggca aggcgaccct ggtgcgggcc gtggcgcacg cggcgggcac gcgcgtggtc       840
     gaggtgtccg cgcccgcgat cgccgtgctg gaggccaacg ccaccgcgcg cgccctcgcc       900
     gacgccatca cccaggccca gtcccagccc ggttccccgg cggtgctcgt gctcaccgac       960
     gtggaggcgc tgctgcccgc cgccaccccg cccccggtgg ccacggtcgt gctcgacgcc      1020
     ctgcgcgccg cgctcgccgc caccccgctc gtggtcacca gcgccagccc ggagctgatc      1080
     gacccgcgcc tgcgcgtccc cgacctggtc gaccgcgagc tggtgctgcc cctgcccgac      1140
     ggcgcgaccc gccgcgagct gctgcgcgcg ctgctgcgcg aggtgcccct cgaaccggac      1200
     gtggacctgg ccgaggtcgc cgaccgcacc cccggcttcg tcgccgccga cctggtggcg      1260
     gtgcgccgcg aggccgccgt ccgctccgcg ctgcgccagc gccaggaggc cgagccgcgc      1320
     gtcgcgcagg aggacctcct cggctcgctg gacaccgtcc gcccgatctc catgtccacc      1380
     tcggacaccc tgcgcaccgg cggcctgacc ctggacgacg tcggcgacat ggccgaggtc      1440
     aagcaggcgc tgaccgaggc cgcgctgtgg ccgctccagt acccggactc gttcgcccgc      1500
     ctcggcgtcg agcccccgcg cggcctgctc ctgtacggcc cgcccggctg cggcaagacg      1560
     ttcctggtcc gcgcgctggc cgggacgggc aagctgaacg tgctgtcggt caagggcgcc      1620
     gagctgatgg acaagttcgt cggcgagtcc gagcgcgcgg tccgcgagct gttccgcagg      1680
     gccgccgagg ccgcgcccgc gctggtgttc ctggacgagg tggacgcgct ggccccgcgc      1740
     cggggccagt cctcggactc gggcgtcgcg gaccgcgtgg tcgccgcgct gctgaccgag      1800
     ctggacggcg tggagccgct gcgcgacgtg atcgtgctgg gcgcgacgaa ccgcccggag      1860
     ctggtcgacc cggccctgct gcgaccgggc aggctggagc gcctggtcta cgtgccgccg      1920
     ccggacgccg aggcccgcgt ggagatcctg cgctccgcgt cccgcaacac cccgctcgcg      1980
     gaggacgtcg agctgaccgc gctggcggac gacctcgacg gctactcggc ggcggactgc      2040
     gccgcgctga tccgcgaggc ggcgctgacc gcgatgcgcg agtccctgtc ggcgaccgcc      2100
     gtgacggcgg agcacctggc gaaggcgcgc ggggtcgtgc gcccgtcgct ggacccggcg      2160
     cagctggcgt cgctggcggc ctacgcggag tccaggaagg cctga                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page