(data stored in ACNUC7421 zone)

EMBL: CP001630.PE426

CP001630.PE426       Location/Qualifiers
FT   CDS_pept        468892..469416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0433"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; KEGG:
FT                   scl:sce7901 ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34400"
FT                   /db_xref="GOA:C6WHU9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34400.1"
FT                   /translation="MDRQDFTRIARERAVPWRRVAYLICGDWGRAEDLVQAALLRMYKH
FT                   WHRIEPRGLEAYARKVISRLALDEAKRASRRKEVLGEVPDRPAAQFDEEVDGAPEVRAA
FT                   LKAMPPRQRAVIVLRFYADLDVAATAKALGITQGTVKSQCSRGLDSLRAALGPHHAALA
FT                   TRTPERTGGSR"
     gtggatcgtc aggacttcac gcggatcgcg cgtgagcggg cggtgccgtg gcggcgggtc        60
     gcgtacctca tctgcgggga ctggggccgg gccgaggacc tcgtgcaggc ggccctcctg       120
     cgcatgtaca agcactggca ccgcatcgag ccgcgcggcc tggaggccta cgcgcgcaag       180
     gtgatctcgc ggctggcgct ggacgaggcc aagcgcgcct cccgccgcaa ggaggtgctg       240
     ggcgaggtcc cggaccgccc ggccgcgcag ttcgacgagg aggtggacgg cgcccccgag       300
     gtgcgggccg cgctcaaggc catgccgccc cgccagcggg ccgtgatcgt cctgcgcttc       360
     tacgcggacc tcgacgtggc ggcgaccgcg aaggcgctcg ggatcaccca gggcacggtg       420
     aagtcccagt gctcgcgcgg gctggactcg ctgcgcgcgg cgctcggccc gcaccacgcg       480
     gccctcgcga ccaggacccc ggagcggacg ggaggcagca ggtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page