(data stored in ACNUC7421 zone)

EMBL: CP001630.PE427

CP001630.PE427       Location/Qualifiers
FT   CDS_pept        469413..470174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0434"
FT                   /product="DnaJ domain protein"
FT                   /note="KEGG: mxa:MXAN_3349 DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34401"
FT                   /db_xref="GOA:C6WHV0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV0"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3349"
FT                   /protein_id="ACU34401.1"
FT                   /translation="MNVRKDFFDHAIGRGEPPVELDFEAIEREGADALRRRRRVVPALA
FT                   MAGVAAVAGGIMALATGAGSTGGLVEQGSGGGDPIPATPAPPSRHSQDAGPSSAATDPS
FT                   PAGSTPPDTGSAPSSTAAGSPQVHRADAWTLEPTAVATADRFPICFSKASMAGYGQAGG
FT                   PETVLVRPVPTSSVAPTPDGVDRFDIALDVCRQFWTDNTRGWRAPDAPVPALVRCVLVL
FT                   PQSPEHGSIGVYPGDEGTCRELGFPVATPAK"
     gtgaacgtgc gcaaggactt cttcgaccac gccatcggga ggggcgaacc cccggtggag        60
     ctggacttcg aggccatcga gcgcgagggc gcggacgccc tgcgccgccg caggcgggtg       120
     gtccccgcac tcgccatggc gggcgtcgcg gcggtcgcgg gcggcatcat ggcgctcgcg       180
     accggtgcgg ggagcacggg aggactggtc gagcagggct cgggcggcgg cgacccgatc       240
     ccggccacgc ccgcgccccc gtcgcggcac agccaggacg cgggcccgtc cagcgccgcg       300
     acggacccgt ccccggccgg ctccacgccg cccgacaccg ggtcggcgcc cagcagcacc       360
     gcggcaggct ccccccaggt ccaccgcgcg gacgcctgga ccctggagcc caccgcggtc       420
     gccaccgccg accggttccc gatctgcttc agcaaggcga gcatggcggg ctacggccag       480
     gcggggggac cggagaccgt cctggtcagg cccgtgccga cctcgtcggt cgccccgacc       540
     ccggacggcg tcgaccgctt cgacatcgcc ctggacgtgt gcaggcagtt ctggaccgac       600
     aacacccgcg gttggcgcgc cccggacgcc ccggtgcccg ccctggtgcg ctgcgtcctc       660
     gtcctgccgc agtcgccgga gcacggctcg atcggcgtgt accccggcga cgaggggacc       720
     tgccgcgaac tcggcttccc ggtggcgacg cccgcgaagt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page