(data stored in ACNUC7421 zone)

EMBL: CP001630.PE428

CP001630.PE428       Location/Qualifiers
FT   CDS_pept        complement(470346..471323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0435"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyltransfera
FT                   se"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mag:amb0603 phosphatidylserine synthase;
FT                   TIGRFAM: CDP-diacylglycerol/serine O-
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34402"
FT                   /db_xref="GOA:C6WHV1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV1"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACU34402.1"
FT                   /translation="MASTAPGVRLLPNAITVLAMCAGLSAVHFAIRGMYGAAIASIAAA
FT                   ALFDGLDGRLARMLDATSKMGAELDSLADSISFGVAPAMVLYVWKFDPDRFGWVVSLVF
FT                   AVCMVLRLARFNTLLDVEQPPYAKEFFVGVPAPIGGLLLLLPLTLDEQLGRSGWWSSTP
FT                   VVAVWTVTVALLLVSRIPTLSIKTIKVPQRLVAPLLVVVALVAAALITFPLAVLVVIEV
FT                   VYLAHLPYAVRRYRWLAKHPEAWEVPPADRRAIRRAHGVAARRLGLRQPMRNRVAGAAR
FT                   RAVRRPRRVDADDVPGPVGSDGAESRRENGGGRRAWRQLGLRRK"
     gtggcgtcga ccgcaccggg cgtccggctg ctgccgaacg ccatcaccgt gctggcgatg        60
     tgcgcgggcc tgtcggccgt gcacttcgcg atcaggggca tgtacggggc ggcgatcgcc       120
     tccatcgcgg cggcggccct gttcgacggg ctcgacgggc ggctcgcccg gatgctcgac       180
     gccaccagca agatgggcgc cgagctggac tcgctggccg actcgatctc gttcggcgtc       240
     gcgcccgcga tggtgctgta cgtgtggaag ttcgacccgg accggttcgg ctgggtcgtg       300
     tcgctggtgt tcgcggtgtg catggtgctg cggctggcgc ggttcaacac cctgctggac       360
     gtcgagcaac cgccgtacgc caaggagttc ttcgtcggcg tgcccgcccc cataggcggg       420
     ttgctgctgc tgctccctct gacgctggac gagcagctgg gccggtccgg ctggtggtcc       480
     tcgacgccgg tggtcgcggt gtggacggtg acggtcgcgc tgctgctggt gagccgcatc       540
     ccgacgctgt ccatcaagac gatcaaggtg ccgcagcggt tggtggcccc gctgctcgtg       600
     gtggtcgcgc tggtcgcggc ggcgctgatc acgttccccc tggcggtgct ggtcgtgatc       660
     gaggtcgtgt acctggcgca cctgccgtac gcggtgcggc ggtaccggtg gctggccaag       720
     caccccgagg cgtgggaggt gcccccggcc gaccggcggg cgatccgcag ggcgcacggg       780
     gtcgcggcgc ggcggctcgg gctgcggcag ccgatgcgga accgggtcgc gggcgcggcg       840
     cggcgggccg tgcggcggcc gaggcgggtc gacgcggacg acgtgcccgg cccggtcggg       900
     tcggacggcg ccgagtcgcg gcgcgagaac ggcggcgggc ggcgggcctg gcggcagctc       960
     gggttgcggc gcaagtga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page