(data stored in ACNUC7421 zone)

EMBL: CP001630.PE429

CP001630.PE429       Location/Qualifiers
FT   CDS_pept        complement(471327..472040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0436"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rce:RC1_1432 phosphatidylserine decarboxylase-
FT                   like protein, putative; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34403"
FT                   /db_xref="GOA:C6WHV2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV2"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ACU34403.1"
FT                   /translation="MTVDRDKHNSGAVSHFIELAKGIVPPMHPAGRPFVAGAAAATLLL
FT                   RRISKPAGVVGALVTAWVAWFFREPKRTTPTRAGLAIAPADGTVSHVVEALPPAELGLG
FT                   SEPMTRISVFLSVFDVHVQRVPVTGVVRQVSYHAGKFLSADLDKASEENERNTVWLTSE
FT                   EGHEIVVVQIAGLVARRIVCEVSEGDAVAAGSTYGLIRFGSRVDLYVPRGSRVLVEAGQ
FT                   RTIGGETVLAELPGN"
     atgacggtcg atcgcgacaa gcacaacagt ggtgccgttt cccacttcat cgagctcgcc        60
     aaggggatcg tccccccgat gcacccggcg ggccgcccgt tcgtcgcagg cgcggcggcg       120
     gcgacgctcc tgctgcgccg gatctccaag cccgccggtg tcgtcggcgc gctggtcacc       180
     gcgtgggtcg cgtggttctt ccgcgagccc aagcgcacca cccccacccg cgcgggcctg       240
     gcgatcgcgc ccgccgacgg caccgtctcg cacgtcgtcg aggccctgcc gcccgccgag       300
     ctgggcctgg gctccgaacc gatgacgcgg atcagcgtgt tcctgtcggt gttcgacgtg       360
     cacgtgcagc gcgtcccggt gaccggcgtc gtccgccagg tctcctacca cgcgggcaag       420
     ttcctctccg ccgacctgga caaggccagc gaggagaacg agcgcaacac ggtgtggctg       480
     acctccgagg agggccacga gatcgtcgtc gtgcagatcg cgggcctggt cgcccggcgc       540
     atcgtgtgcg aggtgtccga gggcgacgcc gtcgccgcgg gctccaccta cggcctgatc       600
     cgcttcgggt cgcgcgtcga cctgtacgtg ccgcgcgggt cccgcgtcct ggtcgaggcg       660
     ggtcagcgca ccatcggcgg ggagaccgtc ctcgccgagc tgccggggaa ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page