(data stored in ACNUC7421 zone)

EMBL: CP001630.PE43

CP001630.PE43        Location/Qualifiers
FT   CDS_pept        complement(46508..47065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0776 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34017"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34017.1"
FT                   /translation="MATRPGVTSRAARGSLVAVTSASLGLAAHGAAGGEAVELTPVLPL
FT                   LLLTASAGTALAERRRTPWAVVGALVSAQAGQHALLSLAAHQHHGPGLGLDPLAMTAAH
FT                   VVAALLTGLLLARADAVLLALAGAAARLLPVLREPRPASRPAALPAPEGHPQPTPVRIT
FT                   LRRVNARRGPPALPIAPHPGPR"
     gtggccactc gaccaggtgt gacgtcccgc gcggcgcgcg ggtccctggt cgcggtgacc        60
     tcggcctcac tgggcctggc ggcccacggc gcggcgggcg gcgaagccgt cgagctgacc       120
     cccgtgctgc ccctgctgct gctcaccgcg agcgcgggga ccgcgctggc cgagcgccgc       180
     cggacgccgt gggcggtggt cggcgcgctg gtctcggcgc aggccgggca gcacgcgctg       240
     ctctcgctcg ccgcgcacca gcaccacggg cccggcctcg gcctcgaccc gctggcgatg       300
     acggcggccc acgtggtcgc cgcgctgctc accggcctgc tgctggccag ggcggacgcg       360
     gtgctgctcg cgctcgcggg cgccgccgcc cggctgctgc cggtgctgcg cgaaccccgc       420
     ccggcgtccc gccccgccgc gctccccgcg cccgagggcc acccccagcc cacccccgtc       480
     cggatcaccc tcaggcgggt gaacgcccgc cggggaccgc ccgcgctccc gatcgccccg       540
     cacccaggac cacgctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page