(data stored in ACNUC7421 zone)

EMBL: CP001630.PE430

CP001630.PE430       Location/Qualifiers
FT   CDS_pept        complement(472257..473768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0437"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sfu:Sfum_1032
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34404"
FT                   /db_xref="GOA:C6WHV3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU34404.1"
FT                   /translation="MRAVLAVGLLIGFFVLFTALTVGLCALTVYGFATGREFNAIKIAL
FT                   IAVPLVLILISALYKALKARGEVEGAPLTREAQPGLWAVVDELAAVAGTRGPDEIRLVG
FT                   AVNAAVSEQAPMLGLRAGRRTLLIGLPLLAGLTASELRSVLAHELGHYGGGHTKLSALT
FT                   YRAKEALVHVVDGLDDTFLQRPFAWYAKLYARVAASVNRRQELDADTASVTAAGREAAQ
FT                   SALRKLPVLGAAWNGYQAQFLSLGAQAELTPPVMAGFHAYLSEPERRGRMDEARAELLA
FT                   REPESVFDSHPPIRERVGRMATLPSPEVERDDRPAWTLLSGATADLERSIMVGGGFGPT
FT                   ADWDEVVSVVAREHGERRAGLLAVAGARAGLPGEVSLDDALAALASTGQRDALLGHLLS
FT                   AELLGGEVPEEQRAQVLAGLLGAVLEHELVAAGVGAYEADWDKRWVVRLEDGRAVDGPP
FT                   LFAEVLGGPERAAEAWKRAADVLGTRRARVTRVQRIAEDLVVPTA"
     atgcgcgcgg ttctcgccgt cggcttgctg atcggcttct tcgtcctctt cacggcgctc        60
     accgtcgggc tgtgcgcgct gacggtgtac ggcttcgcga caggccgcga gttcaacgcc       120
     atcaagatcg cgctgatcgc ggtcccgctg gtcctgatcc tgatcagcgc cctctacaag       180
     gcgctcaagg cgcgcggtga ggtcgagggc gccccgctca cccgcgaggc gcagccaggg       240
     ctgtgggccg tcgtggacga gctggccgcc gtcgcgggca ccaggggccc cgacgagatc       300
     cggctggtgg gcgcggtcaa cgcggccgtg tccgagcagg ctccgatgct gggcctgcgc       360
     gcgggccgcc ggaccctgct gatcggcctg ccgctgctgg ccgggctgac cgcgagcgag       420
     ctgcggtcgg tgctggcgca cgagctgggc cactacggcg gcgggcacac caagctgtcc       480
     gcgctgacct accgcgccaa ggaggcgctg gtgcacgtgg tggacgggct ggacgacacg       540
     ttcctgcagc gcccgttcgc ctggtacgcc aagctctacg cgcgggtggc cgcgtcggtg       600
     aaccgcaggc aggagctgga cgccgacacc gcgtcggtga ccgccgcggg ccgcgaggcc       660
     gcgcagtccg cgctgcggaa gctgccggtg ctgggggcgg cgtggaacgg ctaccaggcg       720
     cagttcctgt cgctgggcgc gcaggccgag ctgaccccgc cggtgatggc cgggttccac       780
     gcctacctgt cggagccgga gcggcggggc cggatggacg aggcgcgggc cgagctgctg       840
     gcgcgcgagc cggagtcggt gttcgacagc cacccgccga tccgcgagcg ggtcggccgg       900
     atggcgacgc tgccctcccc cgaggtcgag cgggacgacc gcccggcgtg gacgctgctg       960
     agcggggcga ccgccgacct ggagcgctcg atcatggtcg gcggcgggtt cgggccgacc      1020
     gccgactggg acgaggtcgt gtccgtggtc gcgcgggagc acggggagcg gcgggccggg      1080
     ctgctggccg tcgccggggc gcgggcgggc ctgcccggcg aggtgtcgct ggacgacgcg      1140
     ctggccgcgc tggcctccac cgggcagcgg gacgcgctgc tggggcacct gctgtcggcg      1200
     gagctgctgg gcggcgaggt gcccgaggag cagcgggcgc aggtgctggc cgggctgctc      1260
     ggcgcggtgc tggagcacga gctggtggcc gccggggtcg gcgcgtacga ggcggactgg      1320
     gacaagcggt gggtggtgcg gctggaggac gggcgcgccg tcgacgggcc gcccctgttc      1380
     gccgaggtgc tgggcgggcc ggagcgcgcg gcggaggcgt ggaagcgggc ggcggacgtg      1440
     ctcgggacgc ggcgcgcgcg ggtgacgcgg gtgcagcgga tcgccgagga cctggtcgtg      1500
     ccgaccgcgt ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page