(data stored in ACNUC7421 zone)

EMBL: CP001630.PE431

CP001630.PE431       Location/Qualifiers
FT   CDS_pept        complement(473915..475120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0438"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: afw:Anae109_1445 molybdenum cofactor synthesis
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34405"
FT                   /db_xref="GOA:C6WHV4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV4"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34405.1"
FT                   /translation="MDGVSNALTGVAAHKARIADLIGVAPVVELPLADCLGLVLASDAV
FT                   APVALPPFDNSAMDGYAVRVADLAELPVVLPVPEDIPAGRTDVVPLEPGTAHRIMTGAP
FT                   VPPGADAVVQVEWTDAGVRSVRIDRGVRLGQNVRWAEDDVKVGEVALRAGRVLGAAQLG
FT                   LVSALGIPALPVRRRLRVLVLSTGSELVAPGEPLLPGQIYESNGLMLAAAVREAGGEAE
FT                   QLRFVPDDVDRFRAVVEERIGGFDLLLTSGGVSAGAYEVVKDALTGRGVEFTKVAMQPG
FT                   GPQGSGRYLGVPVATLPGNPVSAQVSFEVFVRPALRAAMGFVDVERPTAVARLRGSISS
FT                   PSGRTQFRRGAYDAGSGQVVTPVGGPGSHLLSSLALSNCLIEVPAEVDELADGDEVLVR
FT                   LL"
     atggacggcg tgtccaacgc gctgaccgga gtcgctgccc acaaggcccg catcgccgat        60
     ctgatcggcg tcgcgccggt ggtcgagctg ccgctcgccg actgcctggg gctggtgctc       120
     gcctcggacg cggtggcccc ggtggcgctg ccgccgttcg acaactcggc gatggacggc       180
     tacgccgtgc gggtcgccga cctggcggag ctgccggtgg tgctgccggt gccggaggac       240
     atcccggccg ggcgcacgga cgtggtcccg ctggagccgg ggaccgcgca ccggatcatg       300
     acgggcgcgc cggtgccgcc gggcgcggac gcggtcgtgc aggtcgagtg gaccgacgcg       360
     ggcgttcggt cggtgcggat cgaccggggc gtgcggctcg ggcagaacgt gcggtgggcc       420
     gaggacgacg tgaaggtcgg cgaggtcgcg ctgcgggccg gccgggtgct gggggcggcg       480
     cagctggggc tggtgtcggc gctgggcatc cccgcgctgc cggtgcgcag gcggttgcgg       540
     gtgctggtgc tgtcgaccgg gtcggagctg gtggcccccg gcgagccgct gctgccgggg       600
     cagatctacg agtcgaacgg gctgatgctg gcggcggcgg tgcgcgaggc gggcggcgag       660
     gcggagcagc tgcggttcgt gccggacgac gtggaccggt tccgggccgt cgtggaggag       720
     cggatcggcg ggttcgacct gctgctgacc tcgggcgggg tgagcgcggg cgcgtacgag       780
     gtggtgaagg acgcgctgac cgggcggggc gtggagttca cgaaggtggc gatgcagccg       840
     ggtgggccgc agggctcggg ccggtacctg ggggtgccgg tggcgacgct gccggggaac       900
     ccggtgagcg cgcaggtgtc gttcgaggtg ttcgtgcggc ccgcgctgcg ggcggcgatg       960
     gggttcgtgg acgtggagcg gccgacggcg gtggcgcggt tgcgcgggtc gatctcctcg      1020
     ccgtcggggc ggacgcagtt ccggcgcggg gcgtacgacg cgggctcggg ccaggtggtg      1080
     acgccggtgg gcgggccggg ctcgcacctg ctgtcgtcgc tggcgctgag caactgcctg      1140
     atcgaggtgc ccgccgaggt ggacgagctg gcggacggcg acgaggtgct ggtccggctg      1200
     ctctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page