(data stored in ACNUC7421 zone)

EMBL: CP001630.PE432

CP001630.PE432       Location/Qualifiers
FT   CDS_pept        475190..475798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0439"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34406"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV5"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ACU34406.1"
FT                   /translation="MQVRTRHTPGYGVARLLLAPAEPVLVERGSVLGTSYGVGFDTRAK
FT                   GKGVRAALCTAGPEGGWVDVAPGVPGDLHVVDLDGKSGWCFAGDAWLACAGTVGLDPAA
FT                   PPLRALHGGDAGFLNYAFGTGPLVLACAGAVDVVTLEPGELVTLHSGHVLAFADTVQCR
FT                   LRAVSPDLPQSVRDGEGLALDFAGPGLVLTRTRKPRRRS"
     gtgcaggtgc ggaccaggca cacgcccggc tacggcgtcg cgaggctgct gctggccccg        60
     gccgaaccgg tgctcgtgga gcgcggctcc gtgctcggca ccagctacgg cgtcggcttc       120
     gacacccgcg ccaagggcaa gggcgtgcgc gccgcgctgt gcacggcggg ccccgagggc       180
     ggctgggtgg acgtggcccc cggcgtgccc ggcgacctgc acgtggtcga cctggacggc       240
     aagtccggct ggtgcttcgc gggcgacgcc tggctcgcct gcgcgggcac cgtcggcctc       300
     gacccggccg cgccgcccct gcgcgccctg cacggcggcg acgcgggctt cctcaactac       360
     gccttcggca ccggcccgct cgtgctggcc tgcgcgggcg ccgtcgacgt cgtcaccctc       420
     gaacccggcg agctggtcac cctgcacagc ggacacgtgc tcgccttcgc cgacaccgtc       480
     cagtgcaggc tccgcgccgt ctccccggac ctgccgcagt cggtccgcga cggcgagggc       540
     ctcgcgctcg acttcgccgg gcccggactc gtgctcaccc gcacccgcaa accgcgccgc       600
     aggtcgtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page