(data stored in ACNUC7421 zone)

EMBL: CP001630.PE433

CP001630.PE433       Location/Qualifiers
FT   CDS_pept        475930..476136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0440"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ank:AnaeK_2630 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34407"
FT                   /db_xref="GOA:C6WHV6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34407.1"
FT                   /translation="MAVGTVKWFNSEKGYGFIAADGGPDVFVHYSAIMMDGFRTLAEGD
FT                   RVEFEIQAGRDGRSQASDVRKAS"
     ttggctgtcg gcacggtcaa gtggttcaac tcggagaagg ggtacggctt catcgccgcc        60
     gacggcgggc cggacgtctt cgtccactac tcggcgatca tgatggacgg attccgcacg       120
     ctcgccgagg gcgaccgcgt ggagttcgag atccaggcgg gccgcgacgg ccgcagccag       180
     gcctcggacg tccgcaaggc gtcgtga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page