(data stored in ACNUC7421 zone)

EMBL: CP001630.PE434

CP001630.PE434       Location/Qualifiers
FT   CDS_pept        476271..477605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0441"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: ade:Adeh_1074 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34408"
FT                   /db_xref="GOA:C6WHV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU34408.1"
FT                   /translation="MSEDLSGRRLGHYRIDGVLGRGGMSVTYKATDVRLGRKVALKVIG
FT                   EHLTADAEFRERFVDEARNTSAIDHANIVPLYDFDEVDGLLYIAMRLVDGQDLATHIKD
FT                   GPLAPSRALVLLEQVAEALDMLHGKGLVHLDVKPANVLVTTKEATREHVYLADFGLTRR
FT                   GATGHRTRTGDFLGSPTYAAPEHLRGEPLDGRTDQYALACMVFACLTGRPPFQGGVQDV
FT                   IQGHLGSEIPPITSLVSLPPAVDDVLRKGTSKDPAQRFATCHEFITAVTAALGPAAQQT
FT                   TPPRPAGAPAPQQHAGQQHAGPASGGFPAQQGGYPQRPGYQQHQHQQQYPPSEPIRLRP
FT                   PTPVGVSAFSDTKQPRPAWFVPALAGAIAVVVIVILVLVLKPEDEPTRPPSSLPASSGP
FT                   ASPGQALASAPLPGPVLPASALPGAAGVPSAVIGDAQSPSVPPSA"
     gtgtcggagg acctgagcgg acggcggttg gggcactacc ggatcgacgg ggtgctcggt        60
     cgcggtggca tgagcgtcac ctacaaggcc acggacgtca ggctcggccg caaggtggcg       120
     ctgaaggtca tcggcgagca cctgacggcg gacgccgagt tccgcgagcg cttcgtggac       180
     gaggcccgca acacctcggc catcgaccac gcgaacatcg tccccctgta cgacttcgac       240
     gaggtcgacg ggctgctgta catcgccatg cggctggtgg acggccagga cctcgccacc       300
     cacatcaagg acgggcccct cgcgccctcg cgcgccctgg tgctgctgga gcaggtcgcc       360
     gaggcgctgg acatgctgca cggcaagggc ctggtgcacc tggacgtgaa gccggcgaac       420
     gtgctggtca ccacgaagga ggccacccgc gagcacgtgt acctggccga cttcggcctg       480
     acccggcgcg gcgcgaccgg ccaccgcacc cgcaccggcg acttcctcgg ctcgcccacc       540
     tacgccgcgc ccgagcacct gcgcggcgag ccgctggacg gccgcaccga ccagtacgcg       600
     ctggcctgca tggtgttcgc ctgcctgacc ggccgcccgc cgttccaggg cggcgtgcag       660
     gacgtcatcc agggccacct cggctcggag atcccgccga tcacctcgct ggtgtcgctg       720
     ccgcccgccg tggacgacgt gctgcgcaag ggcacctcga aggacccggc gcagcggttc       780
     gcgacctgcc acgagttcat caccgccgtc accgccgcgc tcggcccggc cgcgcagcag       840
     accaccccgc cccgcccggc gggcgcgccc gccccgcagc agcacgcggg ccagcagcac       900
     gcgggcccgg ccagcggcgg cttcccggcc cagcagggcg gctacccgca gcgccccggc       960
     taccagcagc accagcacca gcagcagtac ccgccgtcgg agccgatccg gctgcgcccg      1020
     ccgacgccgg tcggggtgag cgcgttctcg gacaccaagc agccccggcc cgcgtggttc      1080
     gtgcccgcgc tcgcgggggc gatcgcggtc gtggtgatcg tcatcctggt gctggtcctc      1140
     aagccggagg acgagccgac ccggccgccg tcgagcctgc ccgcgtcgtc cggcccggcc      1200
     tcgccgggcc aggccctggc gagcgcgccg ctgcccggcc cggtcctgcc cgcgtccgcg      1260
     ctgccgggtg ccgccggggt cccgtcggcc gtgatcggtg acgcccagtc gccgtccgtt      1320
     cccccgtccg cctga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page