(data stored in ACNUC7421 zone)

EMBL: CP001630.PE435

CP001630.PE435       Location/Qualifiers
FT   CDS_pept        477845..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0442"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bcb:BCB4264_A0298 chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34409"
FT                   /db_xref="GOA:C6WHV8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV8"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACU34409.1"
FT                   /translation="MAKMIAFDEDARRGLERGMNILADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEAVTEQLLKTAKEVETKEQIAATASISAGDSTIGELIAEA
FT                   MDKVGKEGVITVEESNALGLELELTEGMRFDKGYISGYFVSDPERQEAVLEDPYILLYG
FT                   SKIASVKDLLPLLEKVMQSGKPLLIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAILQDIAILTGGQVITEDVGLKLDTADLSLLGKARKVVVTKDETTVVEGSGDAEQI
FT                   QGRVNQIRAEIEKSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVALLQAAEAAFAGLKLEGDEATGANIVKVAVEAPLKQIAVNAGL
FT                   EGGVVVEKVKGLPVGHGLNAATGVYEDLLAAGVPDPTKVTRSALQNAASIAALFLTTEA
FT                   VVADKPEKAGAAPAMPDAGGMDF"
     atggccaaga tgatcgcctt cgacgaggat gcccgccgcg gtcttgagcg aggcatgaac        60
     atcctcgcgg acgccgtcaa ggtgacgctg ggtcccaagg gccgcaacgt cgtgctcgag       120
     aagaagtggg gtgcgccgac gatcaccaac gacggcgtct ccatcgccaa ggagatcgag       180
     ctcgaggacc cgtgggagaa gatcggggcc gagctcgtca aggaagtggc gaagaagacc       240
     gacgacgtcg cgggtgacgg caccacgacc gccaccgtgc tcgcccaggc cctggtccgc       300
     gagggcctgc gcaacgtggc cgcgggcgcc aacccgctgg gcctcaagcg cggcatcgag       360
     aaggccgtcg aggccgtcac ggagcagctg ctgaagaccg ccaaggaggt cgagaccaag       420
     gagcagatcg ccgccacggc gtccatctcc gcgggcgact cgaccatcgg cgagctcatc       480
     gccgaggcca tggacaaggt cggcaaggaa ggcgtcatca ccgtcgagga gagcaacgct       540
     ctcgggctcg agctcgagct caccgagggt atgcgcttcg acaagggcta catctccggc       600
     tacttcgtct ccgacccgga gcgccaggag gccgtgctgg aggacccgta catcctcctc       660
     tacggctcca agatcgcctc ggtcaaggac ctgctgccgc tgctcgagaa ggtcatgcag       720
     agcggcaagc cgctgctgat catctccgag gacgtcgagg gcgaggccct ggcgaccctg       780
     gtggtcaaca agatccgcgg caccttcaag tccgtcgccg tcaaggcgcc cggcttcggc       840
     gaccgccgca aggccatcct gcaggacatc gcgatcctga ccggcggcca ggtcatcacc       900
     gaggacgtcg gcctcaagct ggacaccgcg gacctgtccc tgctgggcaa ggcccgcaag       960
     gtcgtcgtca ccaaggacga gaccaccgtg gtcgagggct ccggtgacgc cgagcagatc      1020
     cagggccgcg tcaaccagat ccgcgccgag atcgagaagt cggactcgga ctacgaccgc      1080
     gagaagctcc aggagcgcct ggccaagctc gccggtggtg tcgcggtcat caaggcgggc      1140
     gccgccaccg aggtggagct caaggagcgc aagcaccgca tcgaggacgc ggtgcgcaac      1200
     gccaaggccg ccgtcgagga gggcatcgtc gccggtggcg gcgtcgcgct gctccaggcc      1260
     gccgaggccg ccttcgcggg cctgaagctc gagggcgacg aggcgaccgg cgccaacatc      1320
     gtcaaggtgg ccgtcgaggc cccgctgaag cagatcgccg tgaacgcggg ccttgagggc      1380
     ggcgtcgtgg tggagaaggt caagggcctc cccgtcggcc acggcctcaa cgccgcgacc      1440
     ggcgtgtacg aggacctgct cgccgcgggc gtcccggacc cgaccaaggt gacccgttcc      1500
     gcgctgcaga acgccgcctc gatcgccgcg ctgttcctca ccaccgaggc cgtcgtggcc      1560
     gacaagccgg agaaggcggg cgcggctccg gccatgcccg acgccggcgg catggacttc      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page