(data stored in ACNUC7421 zone)

EMBL: CP001630.PE436

CP001630.PE436       Location/Qualifiers
FT   CDS_pept        complement(479947..480444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34410"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34410.1"
FT                   /translation="MNNDIDPRDDHRGNNEDTAVLAELRRLVYELDPPPASLVERIQFA
FT                   VALEDLDVEVARWERSASLTGVRGVGQQGTITFTVDDLTLMVNFTSMGARHRIDGWLVP
FT                   AGEHTVEVRVADHGSTTTKADDVGRFVVPDVPAGTTQIIVHLADGAGGVAGKTVVTPTI
FT                   VL"
     gtgaacaacg acatcgatcc gcgcgatgac cacagaggga acaacgagga caccgcagtc        60
     ctcgccgagc tgcggcgact ggtgtacgag ctggacccgc cgcccgccag cctggtggag       120
     cgcatccagt tcgccgtggc gctggaggac ctggacgtcg aggtcgcccg gtgggagcgg       180
     tcggcctcgc tcaccggggt caggggcgtc ggccagcagg ggacgatcac cttcacggtg       240
     gacgacctga ccctgatggt gaacttcacg tccatgggcg ccaggcaccg gatcgacggg       300
     tggctggtgc ccgccgggga gcacaccgtg gaggtcaggg tcgcggacca cgggtcgacc       360
     acgaccaagg ccgacgacgt cgggcggttc gtggtgccgg acgtgcccgc cgggacgacg       420
     cagatcatcg tgcacctggc cgacggcgcg gggggcgtgg ccgggaagac cgtggtcacc       480
     ccgacgatcg tcttgtag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page