(data stored in ACNUC7421 zone)

EMBL: CP001630.PE437

CP001630.PE437       Location/Qualifiers
FT   CDS_pept        complement(480441..481046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0444"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   sus:Acid_3132 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34411"
FT                   /db_xref="GOA:C6WHW0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34411.1"
FT                   /translation="MGELRMTGERPPWEGLDGTDRHEVCVIAARSGDRRALDVLIHDLT
FT                   PLVWHVARGHGLDRSTAEDVVQTVWLALLRNLGRITQPRALAGWLVVATRREAQRTWTP
FT                   SRRESSLSDEMAEQQESHIGLPEDAALVDDRDQRLWRAFGKLSQRCQELLRLTVLAGRA
FT                   EYRAVAEALSMPRGSIGPTRGRCLGTLRAHLEAEGGSR"
     gtgggcgagc tgcgcatgac cggtgagcgc ccaccgtggg aagggctcga cggcacggac        60
     cggcacgagg tctgcgtcat cgccgcccgc tcgggcgatc gccgggcgct ggacgtgctc       120
     atccacgacc tgaccccgct ggtctggcac gtggcgcggg ggcacgggct ggaccggagc       180
     acggccgagg acgtcgtcca gaccgtgtgg ctggccctgc tccggaacct ggggcggatc       240
     acccagccca gggcgctggc cgggtggctg gtggtcgcca cgcgccgcga ggcgcagcgg       300
     acctggacgc cgtcgcggcg cgagtcgtcg ctgtccgacg agatggcgga gcagcaggag       360
     agccacatcg gactgcccga ggacgccgcg ctggtcgacg accgcgacca gcgcttgtgg       420
     cgcgccttcg ggaagctgtc gcagcggtgc caggaactgc tgcggctcac cgtcctcgcc       480
     gggcgggcgg agtaccgcgc ggtggcggaa gcactgtcca tgccccgcgg cagcatcggc       540
     cccaccaggg gtcggtgctt gggcacgctg cgggcgcatc tcgaagcgga aggaggatcg       600
     cggtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page