(data stored in ACNUC7421 zone)

EMBL: CP001630.PE438

CP001630.PE438       Location/Qualifiers
FT   CDS_pept        481427..482101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0445"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bcj:BCAL0655 CutC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34412"
FT                   /db_xref="GOA:C6WHW1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW1"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACU34412.1"
FT                   /translation="MLEIIALTPADAAAAQAGGADRLELVADMVSDGLTPSAEVLRDVL
FT                   STTDLPVRVMLRDAPGFAPADPPSLRRAAALLREAGATEFVLGFLGDGGAVDRGACADL
FT                   LAELEGCAWTFHRALDNAADPEAAWPVAVGLGCDTVLAAGSARGVAEGIPVLERLAARQ
FT                   AADGVRLLVGGGLKREHVPGLARAGATSFHVGGAVRARGWDGPVSEPLVREWATLVAEA
FT                   RG"
     atgttggaga tcatcgccct gaccccggcg gacgcggcag cggcccaggc gggtggcgcg        60
     gaccgcttgg agctggtggc ggacatggtg tcggacggcc tgaccccgtc cgccgaggtg       120
     ctccgcgacg tgctgtccac gacggacctg ccggtgcgcg tgatgctgcg cgacgcgccg       180
     ggcttcgccc ccgccgaccc gccgtccctg cgccgcgcgg cggccctgct gcgggaggcg       240
     ggcgcgaccg agttcgtgct gggcttcctg ggggacgggg gagcggtcga ccggggggcg       300
     tgcgcggacc tgctggcgga gctggagggc tgcgcctgga cgttccaccg cgccctggac       360
     aacgccgccg acccggaggc ggcctggccg gtcgcggtcg ggctgggctg cgacaccgtg       420
     ctggcggcgg gcagcgcgcg cggcgtcgcg gaggggattc cggtgctcga acgcctcgcg       480
     gcgcgccagg cggcggacgg cgtgcgcctg ctggtgggcg gcgggctcaa gcgcgagcac       540
     gtgccgggcc tggcgcgcgc gggcgcgacg tcgttccacg tcggcggcgc ggtccgcgcg       600
     cgcggctggg acggcccggt gtcggagccg ctggtccgcg agtgggccac gctggtggcg       660
     gaggcgcggg gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page