(data stored in ACNUC7421 zone)

EMBL: CP001630.PE439

CP001630.PE439       Location/Qualifiers
FT   CDS_pept        482648..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0446"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL100263 putative substrate-binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34413"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34413.1"
FT                   /translation="MRFLVAAATTALLLTGCAPVQSGPAPEGGDERAGQLRVWLFDEVN
FT                   RAPKEAVVARAVAEFEAAHEGVTVDVQHIQVASRAERFKAAFSDPASAPDVAEFGNTDL
FT                   AGYVAGGGFAPLDLGDWPDAADLAPRIAETGEVDGQLYGLPWYVGVRALYYRTDVFREL
FT                   DLQPPATLADLAPTARAIRAARPDLLGISAGGKYTYGALPFLWAAGGDVARERDGRHTS
FT                   ALTTPESLAGLRRYTELLADDICPPAQCAANGGDASVEAFRAGKAAMVIGGDFNRKSVD
FT                   DSTAGGKYAVVPLPGETAGSIAPAFAGGNLLGVLKGTRRRTLATEFVQLLGGKRYQREM
FT                   FDAMGNLPTFTDVQAEVAAANPALEPFTRTLEAGTRFVPATPDWAKVDAQGVLPTLIQE
FT                   VATGAKGLDAAAADAAARMNDAFGS"
     atgcgcttcc tggtcgccgc cgccacgacg gcactgctcc tcaccggctg cgcgccggtc        60
     cagtccggcc ccgcccccga gggtggcgac gagcgcgccg ggcagctgcg ggtgtggctc       120
     ttcgacgagg tcaaccgggc gcccaaggag gccgtcgtcg cccgtgccgt cgccgagttc       180
     gaggccgcgc acgagggcgt caccgtcgac gtccagcaca tccaggtcgc cagccgcgcc       240
     gagcgcttca aggccgcctt cagcgacccc gccagcgccc ccgacgtcgc cgagttcggc       300
     aacaccgacc tcgcgggcta cgtcgcgggc ggcggcttcg ccccgctcga cctcggcgac       360
     tggcccgacg ccgccgacct ggcccccagg atcgccgaga ccggcgaggt cgacggtcag       420
     ctctacggcc tgccctggta cgtcggcgtc cgtgccctct actaccgcac cgacgtcttc       480
     cgcgagctgg acctccagcc cccggccacc ctcgccgacc tcgcccccac cgcccgcgcg       540
     atccgcgccg cccggcccga cctcctcggc atctcggcgg gcggcaagta cacctacggc       600
     gcgctcccgt tcctctgggc ggcgggcggc gacgtggcgc gcgagcggga cgggcggcac       660
     acctccgccc tcaccacccc cgagtccctc gccggcctgc gccgctacac cgagctgctc       720
     gccgacgaca tctgcccgcc cgcccagtgc gctgccaacg gcggcgacgc cagcgtcgag       780
     gcgttccgcg cgggcaaggc cgccatggtc atcggcggcg acttcaaccg gaagtccgtg       840
     gacgactcga ccgcgggcgg caagtacgcc gtcgtccccc tgcccggcga gaccgcgggc       900
     tcgatcgccc cggcgttcgc gggcggcaac ctgctcggcg tcctcaaggg cacccggcgc       960
     cgcaccctcg ccaccgagtt cgtgcagctc ctcggcggca agcgctacca gcgcgagatg      1020
     ttcgacgcga tgggcaacct gcccacgttc accgacgtgc aggccgaggt cgccgccgcg      1080
     aaccccgccc tggagccgtt cacccgcacc ctggaggcgg gcacccggtt cgtccccgcc      1140
     accccggact gggccaaggt cgacgcgcag ggcgtgctgc ccaccctcat ccaagaagtc      1200
     gccaccggag ccaagggcct ggacgcggcg gcggccgacg cggcggcccg gatgaacgac      1260
     gccttcggct catga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page