(data stored in ACNUC7421 zone)

EMBL: CP001630.PE44

CP001630.PE44        Location/Qualifiers
FT   CDS_pept        47159..48991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0044"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: ppw:PputW619_2676
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34018"
FT                   /db_xref="GOA:C6WCJ7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ACU34018.1"
FT                   /translation="MTTAEPQIKTPLPGEPKVDRPGRTDYVVFGVAAAITVAFLGWGVF
FT                   ATDSLASASKTALGWVMGNLGWAFVLLASGFVLFALWLAVSRYGRIPLGRDDERPEFTT
FT                   VSWIAMMFSAGMGIGLMFYGVNEPLTHFVNPPPGTVEAGSDAALRTAMATTLFHWTLHP
FT                   WAIYAVVGLAIAYSSFRRGRSQLISAAFAPLLGERTANGGVGKAIDVLAIFATLFGSAA
FT                   SLGLGALQIGSGLEIVGWAGEVGNAVLVGVIAVLTVAFIASAVSGVAKGIQWLSNVNMV
FT                   LAVVLALFLFVVGPTVFILNMVPTAIGEYFRELAEMTGRTAATGGDPMETWLSGWTVFY
FT                   WAWWIAWAPFVGMFIARISRGRTIRQFVAGVIGVPSLVSLMWFAIFGGTAIATQRGGAD
FT                   IAGQSTAEGQLFAVLREYPVASVSIVLVMVLVAIFFVSGADAASVVMGTLSQRGSIAPT
FT                   RGVVIFWGVVTGAVGAVMLLVGGSSGLTGLQNLTIIAALPFAVVMVGLCLSLARDLRSD
FT                   PMIRREERVAEVLEEVSTKIGPEEAALRAVESLTKGEGLSRAEKRVRSEAAGKAAEAEG
FT                   DEPAATGGVTAEGSTAQDVTAQDTTAEGGSLTKK"
     gtgacgaccg cagaaccgca gatcaagaca cctctgccgg gggagccgaa ggtcgaccgc        60
     cccggccgca ccgactacgt cgtgttcggc gtggccgccg ctatcaccgt cgccttcctc       120
     ggatggggcg tgttcgccac cgattcgctc gcctctgctt ccaagactgc cctcgggtgg       180
     gtcatgggaa acctgggttg ggcgttcgtg ctgctcgcgt ccggcttcgt cctgttcgcc       240
     ctctggctcg ccgtcagccg ctacggccgc atcccgctcg gccgcgacga cgagcgtccc       300
     gagttcacga ccgtgtcctg gatcgcgatg atgttcagcg cgggcatggg catcggcctg       360
     atgttctacg gcgtcaacga gccgctgacg cacttcgtca acccgccgcc gggcaccgtg       420
     gaggccgggt ccgacgcggc gctgcgcacc gcgatggcca ccaccctgtt ccactggacc       480
     ctccacccgt gggcgatcta cgccgtggtg ggcctggcca tcgcctacag cagcttccgc       540
     aggggccgca gccagctgat cagcgccgcg ttcgcgccgc tgctcggcga gcgcaccgcg       600
     aacggcggcg tcggcaaggc catcgacgtg ctggcgatct tcgccacgct gttcggctcg       660
     gccgcctcgc tcggcctcgg cgcgctgcag atcggcagcg gcctggagat cgtcgggtgg       720
     gccggtgagg tcggcaacgc cgtcctggtc ggcgtcatcg ccgtgctgac cgtggcgttc       780
     atcgcctccg cggtctccgg cgtcgccaag ggcatccagt ggctgtccaa cgtcaacatg       840
     gtgctggccg tcgtgctggc gctgttcctg ttcgtggtcg gcccgaccgt gttcatcctg       900
     aacatggtgc ccaccgcgat cggcgagtac ttccgcgagc tggccgagat gaccggccgc       960
     accgccgcca ccggcggcga ccccatggag acctggctgt ccggctggac cgtcttctac      1020
     tgggcctggt ggatcgcctg ggcgccgttc gtcggcatgt tcatcgcccg gatcagccgg      1080
     ggccgcacca tccgccagtt cgtcgcgggc gtcatcggcg tgccgagcct ggtcagcctg      1140
     atgtggttcg ccatcttcgg cggcaccgcc atcgccaccc agcgcggcgg cgcggacatc      1200
     gcgggccagt ccaccgccga gggccagctg ttcgccgtgc tccgcgagta cccggtcgcg      1260
     tcggtctcga tcgtgctggt catggtgctg gtggcgatct tcttcgtgtc cggggccgac      1320
     gccgcgtcgg tggtcatggg caccctgtcc cagcgcggct ccatcgcccc gaccaggggc      1380
     gtggtgatct tctggggcgt cgtgaccggc gccgtcggcg cggtgatgct gctggtcggc      1440
     gggtcgagcg ggctcaccgg cctgcagaac ctcacgatca tcgcggcgct gccgttcgcc      1500
     gtggtcatgg tcggcctgtg cctgtcgctc gcccgcgacc tgcgcagcga cccgatgatc      1560
     cggcgcgagg agcgggtcgc cgaggtgctg gaggaggtct ccaccaagat cggtccggag      1620
     gaggcggcgc tgcgcgcggt cgagagcctg accaagggcg aggggctgag cagggcggag      1680
     aagcgcgtcc ggtccgaggc ggcggggaag gccgccgagg ccgagggcga cgagcccgcc      1740
     gccaccgggg gcgtcacggc cgagggctcc accgcgcagg acgtcaccgc gcaggacacc      1800
     accgccgagg gcgggagcct gaccaagaag tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page